KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_13920Help
Entry
C6Y53_13920       CDS       T05357                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
thas  Rhodobacteraceae bacterium SH-1
Pathway
thas00010  Glycolysis / Gluconeogenesis
thas00020  Citrate cycle (TCA cycle)
thas00620  Pyruvate metabolism
thas01100  Metabolic pathways
thas01110  Biosynthesis of secondary metabolites
thas01120  Microbial metabolism in diverse environments
thas01130  Biosynthesis of antibiotics
thas01200  Carbon metabolism
Module
thas_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C6Y53_13920
   00020 Citrate cycle (TCA cycle)
    C6Y53_13920
   00620 Pyruvate metabolism
    C6Y53_13920
Enzymes [BR:thas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     C6Y53_13920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AVO38680
UniProt: A0A2S0MS25
LinkDB All DBs
Position
2819708..2821042
Genome map
AA seq 444 aa AA seqDB search
MATEILMPALSPTMEEGTLAKWLVKEGDTVNSGDLLAEIETDKATMEFEAVDEGVVGRIL
VAEGTEGVKVNSPIAILVEEGEEPGDIAAAPSAAAAPEAAQADTAAEAAPAGGSEKAAPP
APAPANAPVQTGGARVFASPLARRIAAEKGLDLGAVKGSGPHGRIVRADVEGAIAAPVAT
PADAPAAAISEAPAPVAALAAGPSADMVARIYEDRNFDEVPLDGMRKTIAARLTEAKQSI
PHFYLRRDIRLDALLAFRSQLNRQLDARGVKLSVNDFIIKACANALQAVPDANAVWAGDR
MLRLKPSDVAVAVAIEGGLFTPVLRDADTKSLSALSAEMKDLATRARDRKLAPHEYQGGS
FAISNLGMFGIDNFDAVINPPHGAILAVGAGVKKPVVGEDGELAVATVMSVTLSVDHRVI
DGALGAKLLQAIVDNLENPVVMLA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaaatcctgatgcccgcgctgagcccgacgatggaggagggcacgctcgcc
aaatggctggtcaaggaaggagacaccgtcaactccggtgatctgctggccgagatcgaa
accgacaaggcgacgatggaattcgaggccgtcgatgaaggcgtcgtcggcaggatcctc
gtggccgagggcaccgagggcgtgaaggtcaattcgcccatcgccattctggtcgaagag
ggcgaagagccgggcgatatcgcggccgcgccctccgctgccgcggcgccggaggccgcc
caggccgacacggctgccgaggcggccccggcagggggctccgagaaagccgcgccgcca
gcaccggcccctgccaacgctcctgtccagaccggcggcgcccgcgtcttcgcctcgccg
ctggcccggcgcatcgccgccgaaaagggtctggacctgggcgccgtcaagggctcgggc
ccgcatggccgcatcgtcagggccgatgtcgaaggggccattgcggcccctgttgcgacc
cctgctgacgccccggcggcggcgatctccgaggcccccgcgcccgtggccgctctggcg
gcggggccgtccgccgacatggtcgcgcgcatatacgaagatcgcaacttcgacgaagtc
ccgctcgacggcatgcgcaagaccatcgccgcgcggctgaccgaggccaagcagtcgatc
ccgcatttctacctgcgccgcgacatccgcctcgatgcgctgctggcgttccggtcccag
ctgaaccggcagctggacgcgcgcggggtcaagctgtcggtcaatgatttcatcatcaag
gcctgcgccaacgcgctgcaggcggtgcccgacgccaacgcggtctgggccggcgaccgg
atgctccggctgaaaccgtcggatgttgcggttgccgttgccatcgagggcgggctgttc
accccggtcctgcgggacgccgacaccaaatcgctgtcggcgctgtcggccgagatgaag
gatctcgccacccgcgcccgcgaccgcaaactggcgccgcatgaataccagggcggcagc
tttgccatctccaacctgggcatgttcgggatcgacaatttcgacgcggtgatcaacccg
ccgcatggggcgatcctggcggtcggcgctggcgtgaagaaacccgtcgttggcgaagat
ggcgaactggccgtggccacggtgatgtcggtgacgctctcggtcgatcaccgggtcatc
gacggggcgctgggtgcaaaactgctgcaggcgatcgtggacaacctggaaaatccggtg
gtgatgctggcctga

DBGET integrated database retrieval system