KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_13975Help
Entry
C6Y53_13975       CDS       T05357                                 

Gene name
aceE
Definition
(GenBank) pyruvate dehydrogenase (acetyl-transferring), homodimeric type
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
thas  Rhodobacteraceae bacterium SH-1
Pathway
thas00010  Glycolysis / Gluconeogenesis
thas00020  Citrate cycle (TCA cycle)
thas00620  Pyruvate metabolism
thas01100  Metabolic pathways
thas01110  Biosynthesis of secondary metabolites
thas01120  Microbial metabolism in diverse environments
thas01130  Biosynthesis of antibiotics
thas01200  Carbon metabolism
Module
thas_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C6Y53_13975 (aceE)
   00020 Citrate cycle (TCA cycle)
    C6Y53_13975 (aceE)
   00620 Pyruvate metabolism
    C6Y53_13975 (aceE)
Enzymes [BR:thas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     C6Y53_13975 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AVO38691
UniProt: A0A2S0MSH8
LinkDB All DBs
Position
2832340..2835000
Genome map
AA seq 886 aa AA seqDB search
MPNDHADIDPIESQEWQDAIADVIERDGANRAHQLLDKAVQQARAAGANLPFSATTPYQN
TIAPDDEVDIPGDTEMEWRIRTINRWNAMATVVKRNKVSSEYGGHIASFASSAALYDIGL
NHFWRSKSAIHGGDLVFFQGHVIPGIYARSFMEGRISTEQLEAFRSEVNGGGLSSYPHPW
LMPDYWQFPTVSMGLGPLMAIYQARFMKYMHNRGLIDAADRKVWCFLGDGEMDEPESRGA
IDLAKREGLDNLIFVVNCNLQRLDGPVRGNGKIVQELEGGFRGAGWDVIKLLWGKGWDDL
LERDTSGKLRQLMDETVDGDYQTFKSKDGAYIRKHFFGTYPETAALVEDWTDEQIWALRR
GGHDPQKVYNAFLRATRAKGSPTCLLVKTVKGYGMGSGGEGMNTSHQQKKLQLDQLKAMR
DRFQIPVTDEELEKDIPFVSLNNAQKAYLADRRKDLGGDFPKRDWRDAPKLEIPALDRFK
GQLESTGEREISTTMAFVRILTTLLRDKQVGKHVVPIVPDESRTFGMEGLFRSVGIYNPL
GQRYTPEDKEQMMFYRESENGQVLQEGINEAGAMADWIAAATSYSNHGVPMIPFFIYYSM
FGFQRIGDLAWAAGDSRARGFMLGGTAGRTTLNGEGLQHEDGHSHILAGTIPNCISYDPT
FSYEVAVIVQNGLQRMFADQEDVYFYLTLMNENYQHPVMPMGAEDGIIKGLYRFRKTAKP
GKKHVNLLGSGTILVQAIRAAEMLKEDFGVTSDIWSATSLNELAREGQDCARHNRLNPLS
DPKVPYVTQQLGQAKGPIIAATDYMKNYAEQIRAFVPGRFTVLGTDGFGRSDSRVNLRRF
FEVDANHIAAAAIVDLYQEGRVTRKDLELALRKYDIDGQKPNPRLV
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacgaccacgcggacatagatccgatcgaaagccaggaatggcaggatgccatc
gccgatgtcatcgaacgcgacggtgcgaaccgagcccatcagctactcgacaaggccgtc
cagcaagcacgggccgccggtgccaacctgccgttctcggcgacgacgccgtatcagaac
accatcgcgccggatgacgaagtcgacatccccggcgacacggaaatggaatggcgcatc
cggaccatcaaccgctggaacgcgatggcgaccgtcgtgaaacgcaacaaggtcagcagc
gaatatggcgggcatatcgcgtccttcgcatcgtctgccgcgctctatgatatcggcctc
aaccatttctggcgctcgaaatcggcgatccatggtggcgacctggtgttctttcagggc
catgtgatcccgggcatctatgcgcggtccttcatggaaggccgcatcagcaccgagcag
ctcgaagcgttccgttcggaggtgaatggcggcggactgagttcttatccgcacccgtgg
ttgatgcccgattactggcagttccccaccgtctcgatggggctcgggccgctgatggcg
atctatcaggcgcggttcatgaaatacatgcacaaccggggtctgatcgatgccgccgac
cgcaaggtctggtgtttcctcggcgatggcgagatggacgagcccgaaagccggggcgcc
atcgacctcgccaaacgtgaggggctcgacaacctgattttcgtcgtgaattgcaacctg
cagcgcctggatggcccggttcgcggcaatggcaagatcgtgcaggagcttgaaggcggt
ttccgcggtgcgggctgggacgtcatcaagctgctctggggcaagggctgggacgacctg
ctcgagcgcgacacctccggcaagctgcgtcagttgatggatgaaaccgtcgatggcgac
taccagacgttcaaatccaaggatggtgcctatatccgcaagcatttcttcgggacctat
ccggagacggcggcactggtcgaggactggacggatgagcagatctgggcgctgcggcgc
ggcggtcacgatccccagaaggtctataacgccttcctgcgcgcgacccgggccaagggc
agcccgacctgtctgctggtgaaaaccgtcaagggatacgggatgggctctggcggagaa
ggtatgaacacctcgcaccagcaaaagaagctgcaactggatcagctcaaggcgatgcgg
gaccggttccagatccccgtgaccgatgaagagctggaaaaggacattccgttcgtcagc
ctgaacaacgcgcagaaggcctatctggccgaccgccgcaaagacctgggtggcgatttc
ccaaagcgggattggcgcgacgcacccaagctggaaatcccggcattggaccggttcaaa
ggtcagctcgaatcgaccggcgagcgcgaaatctcgaccacgatggcgttcgtgcggatc
ctgaccaccctgttgcgggacaagcaggtcggcaagcatgtcgtgccgatcgtgccggac
gaaagccgcaccttcgggatggaaggcctgttccggtcggtcggcatctacaacccgctg
ggccagcgatacacgcccgaagacaaagaacagatgatgttctaccgggaatccgaaaac
ggccaggttctgcaggaaggcatcaacgaagcgggcgcgatggcggactggatcgcggcg
gcaacgtcgtattccaaccacggcgtgccgatgatcccgttcttcatctactattcgatg
ttcggtttccagcggatcggtgatctggcctgggccgcaggcgatagccgcgcgcgcggc
ttcatgctgggtggaaccgctggccggaccacgctgaacggcgaagggttgcagcacgag
gacgggcacagccacatccttgccggcacgatcccgaattgcatcagctatgacccgacc
ttttcctacgaggtcgcggtgatcgtgcagaacgggttgcagcgcatgtttgccgatcag
gaagacgtctatttctacctgacgctgatgaacgagaactatcagcatcccgtgatgccg
atgggcgcggaagacgggatcatcaagggtctctaccggttccggaaaaccgcgaagccg
ggcaagaagcatgtcaatcttctgggctccggcacgatcctcgtccaggcgatcagggcg
gccgagatgctgaaggaagatttcggcgtgacctcggatatctggtcggcgacatcgctc
aacgaactggcgcgcgagggccaggattgtgcgcgtcacaaccgcttgaacccgctgagc
gatccgaaggtgccatatgtgacgcagcagctcgggcaggcaaaaggcccgatcatcgcg
gcgaccgactacatgaagaactacgccgaacagatccgtgcctttgtgccggggcggttc
acggttctgggcaccgacggctttggccggtccgacagccgtgtgaaccttcgccgcttc
ttcgaggtggacgcgaaccatatcgcggcggcggccatcgtggacctctatcaggaaggc
cgcgtgaccagaaaggacctggagctcgctctcaggaaatatgacatcgacggccaaaag
ccgaacccccgtctggtgtaa

DBGET integrated database retrieval system