KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_14310Help
Entry
C6Y53_14310       CDS       T05357                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
thas  Rhodobacteraceae bacterium SH-1
Pathway
thas00330  Arginine and proline metabolism
thas00360  Phenylalanine metabolism
thas00380  Tryptophan metabolism
thas00627  Aminobenzoate degradation
thas00643  Styrene degradation
thas01100  Metabolic pathways
thas01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    C6Y53_14310
   00360 Phenylalanine metabolism
    C6Y53_14310
   00380 Tryptophan metabolism
    C6Y53_14310
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    C6Y53_14310
   00643 Styrene degradation
    C6Y53_14310
Enzymes [BR:thas01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     C6Y53_14310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Phage_TAC_6
Motif
Other DBs
NCBI-ProteinID: AVO38749
UniProt: A0A2S0MS79
LinkDB All DBs
Position
complement(2911704..2913134)
Genome map
AA seq 476 aa AA seqDB search
MGNTELWRLTATETATATRAGDVTAEAVTRAALDRMAAANPALNAVVDPLDAEALERARA
LDAARAGGAAPGPLHGVPVTIKINVDQKGHATSNGVVALKDLIAPDDAPLVKNLQDAGAV
VIGRTNTPEFSFRADTDNPLFGRTHNPWGDHVSAGGSSGGAGAAVMAGIGALAHGNDIGG
SLRFPAAANGAVTVKPGLGRIAAWNPSQTAERGMLAQAMSVQGLLTRCAEDLHLSMPTMI
APDPRDPFHVPLPWRGEASDGPIRVGFTRDTFGFDLHPEVALALDAARDALRDAGYTVEE
IDPPAMPETGSDGYRALMGEVKALMGPDIRANGSATINAIFDEYFDQFTPFEGTDLLRMM
ARRSHYAREWSLFLDRYPLVLCPFLPQPFFAPDRDVQGAEGVREVLGSAIWSYAMNFVGL
PAGCVPARLSELSAGPQPISVQIVGRRWREDLVVDACAAVEQRLGRMCDALWARMG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaccgaactctggcggctgaccgccaccgaaaccgcaactgcaacccgcgcg
ggcgatgtcaccgccgaggccgtcacccgcgcggccctggaccggatggcggcggccaac
ccggcgctgaacgcggtggtcgatccgctcgatgccgaggcgctggaacgcgcccgcgca
ctggacgcggcgcgggccggcggggccgcccccggcccgctgcacggcgtaccggtcacg
atcaagatcaacgtcgaccagaagggccatgcgacctcgaacggggtggtggcgctgaag
gatctgattgcgccggatgacgccccgctggtgaagaacctgcaggatgcgggtgcggtg
gtgatcgggcgcaccaacacgccggaattctcgtttcgcgccgataccgacaacccgctg
ttcgggcgcacgcacaacccctggggcgatcatgtctcggccggcgggtcgtcgggcggc
gcgggcgcggcggtgatggcgggcatcggcgcgctggcgcacggcaacgacatcggcggc
tcgctgcggtttcccgccgccgccaacggcgcggtcacggtcaaacccggcctgggccgg
atcgcggcgtggaacccgtcgcagacggccgaacgcggcatgctggcccaggcgatgtcg
gtgcaggggctgctgacccgctgcgccgaggacctgcacctgtcgatgccgacgatgatc
gcgcccgacccgcgcgatccgttccatgttcccctgccctggcgcggcgaggcatcggac
gggccgattcgcgtcggtttcacgcgcgacacctttggtttcgacctccaccccgaggtg
gcgctggcgctggacgcggcgcgcgatgccctgcgcgatgccggatataccgtcgaggaa
atcgacccccccgccatgcccgaaaccggcagcgacggctatcgcgcgctcatgggcgag
gtgaaagcgctgatggggccggacatccgggccaatggctcggccacgatcaacgccatc
ttcgacgagtatttcgaccagtttaccccgttcgaaggcaccgacctgttgcgcatgatg
gcccggcgcagccactatgcgcgggaatggtcgctgttcctggatcgctatccgctggtg
ctgtgtccgttcctgccacaacccttctttgcgcccgaccgtgacgtgcagggcgccgag
ggcgtgcgcgaggtgctgggcagcgcgatctggtcctacgcgatgaacttcgtggggttg
ccggcgggttgcgtgcccgcgcgcctgtccgaactctcggccgggccgcagccgatcagc
gtgcaaatcgtgggccggcgctggcgcgaggacctggtggtcgatgcctgcgccgccgtc
gaacaacggctgggccggatgtgcgacgcgctgtgggcgcggatgggctga

DBGET integrated database retrieval system