KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_14345Help
Entry
C6Y53_14345       CDS       T05357                                 

Definition
(GenBank) hypothetical protein
Organism
thas  Rhodobacteraceae bacterium SH-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAT_signal LPAM_2
Motif
Other DBs
NCBI-ProteinID: AVO38756
UniProt: A0A2S0MSB6
LinkDB All DBs
Position
2921574..2922182
Genome map
AA seq 202 aa AA seqDB search
MKRRTFLTMTGMTALLAACGQWKVGYDNAPDAAQAAGWRVTSVRVTVPQSLSVSEENVLA
PRADIVWQGEPAGDRRAQVAQIVETGARRGAAGLKGGRPVRLDITMLRFHALTQRAREKL
SSSGVHSIDMTVRVIDVATGQVLAEEPRLEADLPALSGKQAIAADQQGQTQKVRITNHIA
VVIASWLGTGPDARGSFSRIGV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcagaaccttcctgacgatgacgggcatgaccgccttgctggctgcctgcgga
cagtggaaagtgggctatgacaacgcacccgatgcggcgcaggccgcgggctggcgggtg
acctcggtgcgtgtcacggtgccgcaaagcctgagcgtgtccgaggaaaacgtcctcgcg
ccaagggccgacatcgtgtggcaaggcgagcccgcgggcgaccggcgcgcgcaggtggcg
cagattgtcgaaacgggtgcccggcgcggggcggcggggctgaaaggcggccgtccggtg
cggctcgatatcaccatgttgcggttccatgccctcacccagcgggcgcgcgaaaagctg
tccagttcgggtgtgcattcgatcgacatgacggtgcgggtgatcgatgtcgcgaccggc
caggtgctggccgaagaaccgcggctcgaagccgacctgccggcactgtccggcaaacag
gccatcgcggccgatcagcagggccagacccagaaggtgcggatcaccaaccatatcgcc
gtggtgatcgccagttggctgggcacagggccggatgcgcggggcagtttctcgcggatc
ggggtctga

DBGET integrated database retrieval system