KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_18710Help
Entry
C6Y53_18710       CDS       T05357                                 

Definition
(GenBank) phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
thas  Rhodobacteraceae bacterium SH-1
Pathway
thas00010  Glycolysis / Gluconeogenesis
thas00680  Methane metabolism
thas01100  Metabolic pathways
thas01110  Biosynthesis of secondary metabolites
thas01120  Microbial metabolism in diverse environments
thas01130  Biosynthesis of antibiotics
thas01200  Carbon metabolism
thas01230  Biosynthesis of amino acids
thas03018  RNA degradation
Module
thas_M00002  Glycolysis, core module involving three-carbon compounds
thas_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C6Y53_18710
  09102 Energy metabolism
   00680 Methane metabolism
    C6Y53_18710
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    C6Y53_18710
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:thas03019]
    C6Y53_18710
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:thas04147]
    C6Y53_18710
Enzymes [BR:thas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     C6Y53_18710
Messenger RNA biogenesis [BR:thas03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     C6Y53_18710
Exosome [BR:thas04147]
 Exosomal proteins
  Proteins found in most exosomes
   C6Y53_18710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-ProteinID: AVO39524
UniProt: A0A2S0MUF0
LinkDB All DBs
Position
complement(3863670..3864947)
Genome map
AA seq 425 aa AA seqDB search
MSTIIDIHAREILDSRGNPTVEVDVILEDGTMGRAAVPSGASTGAHEAVERRDGDAARYL
GKGVLEAVAAVNGEIAEELLGHDATEQVAIDEAMIELDGTANKGRLGANAILGVSLAVAK
AAADFTTQPLYRYVGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAADNIRDAVR
MGAEVFHTLKKELSAAGLATGVGDEGGFAPNIASTREALDFILKSIETAGYKPGDDIHLA
LDCAATEYYKDGKYVLAGEGKTLSSEENAAYLAALVADYPIISIEDGMGEDDWDGWKALT
DLLGDKVQLVGDDLFVTNPARLAEGIAKGCANSMLVKVNQIGSLTETLRAVDMAHRAGFT
NVMSHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEESLGETAIYAGR
SILRG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatcatcgacatccacgcccgcgagatcctcgacagccggggcaacccgacc
gtagaggtggacgtgatcctcgaagacggcaccatgggccgtgccgccgtgccgtcgggg
gcctcgaccggcgcccatgaagccgtggaacggcgcgacggcgatgccgcccgttatctg
ggcaagggcgtcctcgaggcggtcgcggcggtcaatggcgagatcgccgaagaattgctg
ggccatgacgccaccgagcaggtcgccatcgacgaggcgatgatcgaactggacggcacc
gccaacaaggggcggctcggcgccaatgcgatcctgggcgtatcgctggcggtggccaag
gcggcggcggatttcacgacccagccgctctatcgctatgtcggcggaacctcggcacgg
gtgctgccggtgccgatgatgaacatcatcaatggcggcgaacatgccgacaacccgatc
gacatccaggaattcatgatcatgccggtcgccgcggacaatatccgcgacgcggtgcgc
atgggtgccgaagtgttccacacgctgaaaaaggaactctcggcggcggggctggccacc
ggtgtcggcgacgagggcggctttgccccgaacatcgcctcgacccgcgaggcgctggat
ttcatcctcaagtcgatcgagaccgcgggctacaagccgggcgacgacatccatctggcg
ctcgattgcgcggcgaccgaatactacaaggacggtaaatatgtccttgccggggaagga
aaaaccctgagctcggaggaaaacgcggcctacctggcggcgctggttgccgattacccg
atcatctcgatcgaggacgggatgggtgaagacgactgggacggctggaaggcgctgacc
gacctgctgggggacaaggtgcaactggttggcgacgacctgttcgtgaccaacccggcg
cggctggccgagggcatcgcaaagggctgtgccaactcgatgctggtcaaggtgaaccag
atcgggtcgctaaccgaaacgctgcgggccgtggacatggcccatcgcgccgggttcacc
aacgtgatgtcgcaccggtccggcgaaaccgaggatgcaaccatcgccgatctcgcggtg
gccaccaattgcgggcagatcaagaccgggtcgctggcgcggtccgatcggctggcaaaa
tacaaccagttgatccgtatcgaggaatcgctgggcgaaaccgcgatctacgcgggccgg
tcgatcctcaggggctga

DBGET integrated database retrieval system