KEGG   Thermofilum adornatus: N186_03220Help
Entry
N186_03220        CDS       T02802                                 

Gene name
porA
Definition
(GenBank) 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
thb  Thermofilum adornatus
Pathway
thb00010  Glycolysis / Gluconeogenesis
thb00020  Citrate cycle (TCA cycle)
thb00620  Pyruvate metabolism
thb00633  Nitrotoluene degradation
thb00640  Propanoate metabolism
thb00650  Butanoate metabolism
thb00680  Methane metabolism
thb00720  Carbon fixation pathways in prokaryotes
thb01100  Metabolic pathways
thb01110  Biosynthesis of secondary metabolites
thb01120  Microbial metabolism in diverse environments
thb01130  Biosynthesis of antibiotics
thb01200  Carbon metabolism
Module
thb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    N186_03220 (porA)
   00020 Citrate cycle (TCA cycle)
    N186_03220 (porA)
   00620 Pyruvate metabolism
    N186_03220 (porA)
   00640 Propanoate metabolism
    N186_03220 (porA)
   00650 Butanoate metabolism
    N186_03220 (porA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    N186_03220 (porA)
   00680 Methane metabolism
    N186_03220 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    N186_03220 (porA)
Enzymes [BR:thb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     N186_03220 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C OxoGdeHyase_C MRP-S22 Amidase02_C
Motif
Other DBs
NCBI-ProteinID: AGT35018
UniProt: S5ZDE9
LinkDB All DBs
Position
563502..564686
Genome map
AA seq 394 aa AA seqDB search
MMGKRVGMNGDRAVAFAAKQAKVDVISAYPITPQTIIVETLAEYVNNGELDAAFIPVESE
HSALSAAIGASLAGARVFTATSSQGLALMWEILWIAAGLRAPIVMAMGNRALSPNINIHC
SHDDAYAARDTGWLQLFAENVQEAYDLTLLAFKIAEDHRVLLPTIVNLDGFILTHAAEGL
YVLDDKDVDSFLPPRKPVNPIDPDNPKTYGPLDFTDWYMEHRKIWYDTYPNVPQVIKEAF
AEYEKLTGRRYVQIKTFNAEDADKAIVILGSSAGTARYAARKLKEKGQNMAVISLTQYRP
FPRKELRTILEKFDVVAVLDRSLSFGSPGNQLFMDVATSLYNAKKKPLLVNVVYGLGGRD
FTPRHVEQVYQLMEEVQKRGEAPEEPVWVGLREA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgatgggaaaacgtgtcggaatgaatggggacagggctgtagcatttgccgctaaacag
gcaaaggtcgacgtgatctccgcttacccaataaccccccagacaataattgtcgagaca
ctcgccgagtatgtgaacaatggtgaacttgatgccgcttttatcccagtggagagtgag
cacagtgctctatcggctgctatcggtgcctcactggctggggcaagagtattcacggca
acgagtagccagggacttgcactaatgtgggaaatcctctggatagccgctggtctaaga
gcgccgatagtcatggcaatgggcaaccgcgcgctctcgcccaacattaatatccactgt
agccacgacgacgcctatgctgcacgcgacacgggatggcttcaattattcgctgaaaac
gtccaggaagcatacgacctaacactgttggctttcaaaattgccgaggaccaccgcgtc
ctactacccacaatagtcaacctagacggattcatacttacgcacgccgcagaggggctc
tacgtcctagacgacaaagatgttgacagcttccttccgccgcggaagccagtaaaccca
atagacccagataacccaaagacctatgggccactcgactttaccgactggtacatggag
cacagaaaaatctggtacgacacgtatccaaatgtaccacaggtaattaaggaggccttc
gccgaatatgagaaactcaccgggagaagatatgtccagataaagaccttcaacgccgag
gacgccgacaaagccatagttattctaggctcgtccgcaggcaccgcaaggtatgcggct
aggaaactaaaagaaaaaggacaaaacatggccgttataagtctgacgcagtacaggcca
ttcccaagaaaagagctaagaaccatacttgaaaaattcgacgtggtagcggtcctcgac
aggagcctaagttttggaagccctggaaaccagctcttcatggatgtcgccacatccctg
tacaacgcgaaaaagaagcctcttctagttaacgtcgtctatggtctcggcggcagagac
tttactccacgccacgtggagcaggtgtaccagttaatggaggaggtacaaaagaggggt
gaagctcccgaagagcctgtttgggtaggattaagggaggcatga

DBGET integrated database retrieval system