KEGG   Thermofilum adornatus: N186_05120Help
Entry
N186_05120        CDS       T02802                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
thb  Thermofilum adornatus
Pathway
thb03030  DNA replication
thb03410  Base excision repair
thb03420  Nucleotide excision repair
thb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:thb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    N186_05120
   03410 Base excision repair
    N186_05120
   03420 Nucleotide excision repair
    N186_05120
   03430 Mismatch repair
    N186_05120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:thb03032]
    N186_05120
   03400 DNA repair and recombination proteins [BR:thb03400]
    N186_05120
Enzymes [BR:thb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     N186_05120
    6.5.1.6  DNA ligase (ATP or NAD+)
     N186_05120
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     N186_05120
DNA replication proteins [BR:thb03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    N186_05120
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     N186_05120
DNA repair and recombination proteins [BR:thb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     N186_05120
   NER (nucleotide excision repair)
    Other NER factors
     N186_05120
   MMR (mismatch excision repair)
    Other MMR factors
     N186_05120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AGT35370
UniProt: S5Z7M5
LinkDB All DBs
Position
904254..906065
Genome map
AA seq 603 aa AA seqDB search
MSQTGEDLPYSVLADFYEKIESITSRIAMTDYLVALFKKTPPSIIDKVIYLTQGQLRPDY
EGVELGVAEKLALRALARATGRHVKDVEDMYKQTGDIGLLAEKLMSTSRTGGLLDFIGTM
EPKKELTVSQVYNALLRIAQATGEGAQETKINTLVSLLKDAKPKEARYILRTVLGRLRLG
IADMTILDALAIAFTGSKNTRDIVEKAYTKHPDLGYIAKLLASQGIDAVASLKIEVGVPI
LPMLAERLSDPDEILQKLGGKCLAEYKYDGERVQAHKKGEKVWLFSRRLENITHHYPDVV
EYMKQLKADEAIVEGEIVAYNPDTGEMLPFQELMHRRRKYDVDKAMKEYPVRVYLFDIVY
LSGRELIDEPLPDRRQNLEKIVPEGQENLLLSSAKIIDNSKDLLHFFEQAISDGCEGIMC
KSIGPDSVYQMGARGWLWIKFKRDYRLEMTDTVDLVVVGAFKGRGKRAGTYGALLMAAYD
PETDTFKTVCKVGSGFTDEDLANLPKMLEPYILPHRHPRVFSKMEADVWFVPAVVLEIIG
AEITLSPLHTCALNKIEEGVGLAIRFPRFTGRYRFDKKPEQATTEAELIEMYKSQRKTII
QQS
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaccggagaagatttaccatattcggttctagcagacttctacgaaaaaatc
gagtctataaccagcaggattgccatgacagattaccttgttgcacttttcaagaaaaca
ccccccagcataattgacaaggtcatatacctgactcagggacagctccgtccagactat
gagggcgtagagctaggagtagccgagaaactggctctaagagctttggcaagagccacc
ggtagacatgtgaaagacgtagaagatatgtataagcaaactggggacatagggcttctc
gccgaaaaactcatgtctacttcccgcaccggtggactactagacttcattggaaccatg
gagcccaaaaaagagctaacagtttcacaagtctacaacgcgctcctaagaattgcgcag
gcaaccggtgaaggagcccaggaaacaaaaataaatacgcttgtatctttgcttaaggat
gctaagccaaaagaagcaagatatattcttcgaacagtcctgggaagactaaggctaggc
atagctgacatgacgatacttgacgcactggcaatagcctttacagggtctaaaaatacc
agggacatagtcgagaaggcatacactaagcatcccgacctcggctacatagcaaagttg
ctagcctcacagggaatagatgcggtggcatcgctcaagatagaagtaggtgtcccaata
ctaccaatgctggcagagagactaagcgacccagacgaaatactgcaaaagcttggcggc
aaatgtcttgcagagtacaagtatgacggggaaagagtccaagcccacaaaaaaggcgaa
aaggtctggctgttcagcagacgcctagaaaacattacacatcactatccggacgtcgta
gaatatatgaagcaacttaaagcggacgaagcgatagttgaaggagaaatagtagcctac
aaccctgacacaggcgaaatgctacctttccaggaactcatgcacaggagacgaaaatac
gacgtagacaaagccatgaaagagtatcctgtaagggtctatctctttgatatcgtctac
ttgtctggacgagaactcattgatgaacctcttcccgacaggagacagaatcttgaaaaa
atagttccagaaggccaggaaaacctcttgttaagtagcgctaaaatcattgacaactcc
aaggatcttttgcacttctttgaacaggctataagtgatggatgcgagggtataatgtgt
aaatccattggtccggacagcgtctaccagatgggtgcaagaggctggctatggataaaa
ttcaaacgggactataggcttgagatgaccgacactgtagacctggtcgttgtcggcgcc
ttcaagggaagaggcaaaagagcggggacttatggtgcgttgctcatggcagcatacgat
cctgaaacagacaccttcaagactgtatgcaaggttggttcaggctttacagatgaggat
ctagcaaacctgcctaaaatgcttgaaccatacatcttgccgcataggcatccaagagta
ttttccaaaatggaggcagacgtctggtttgttccagccgttgtccttgaaataattggc
gcggaaataactctaagcccattacatacttgtgcattaaacaaaatagaagaaggcgta
ggtctagccataaggtttccacgcttcactggtagatacaggtttgacaagaagccagaa
caagctacaaccgaggccgagctaatcgagatgtataagtcccagagaaaaacaataatc
cagcagtcctag

DBGET integrated database retrieval system