KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_10880Help
Entry
TCCBUS3UF1_10880  CDS       T01866                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00620  Pyruvate metabolism
thc00680  Methane metabolism
thc00710  Carbon fixation in photosynthetic organisms
thc01100  Metabolic pathways
thc01120  Microbial metabolism in diverse environments
thc01200  Carbon metabolism
Module
thc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:thc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TCCBUS3UF1_10880
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TCCBUS3UF1_10880
   00680 Methane metabolism
    TCCBUS3UF1_10880
Enzymes [BR:thc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TCCBUS3UF1_10880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF4350
Motif
Other DBs
NCBI-ProteinID: AEV16133
UniProt: G8NCZ2
LinkDB All DBs
Position
1066580..1069156
Genome map
AA seq 858 aa AA seqDB search
MTPEPFDRLRAEVDLLGRLLGEAIRAVSGERILALVEEVRHLAKARRQGEEGAGEALGRR
VEGLSLAEAEALVRAFTHYFHLVNLAEERHRVRVNRLRAEAETLENPRPEGFLALAKALK
ERGLSLEEAEAHLNRLELHLTFTAHPTETRRRTLRHHLERLGEELEAGEKERLLARVALL
YATEEVRKARPSVEDEIKGGLYYLPTTLWRAIPRVVAGLEAALERVYGRRPRLRSPVRFR
SWIGGDRDGNPFVTPEVTAFAARYARQVARERFLQELEALVRDLSLAEARVPVPREVRSG
GEGVERFPGEAYRRFFAGLYGRLEREELTTEGLLRAVRLAEGGLEGVGLGPVARAFLRPL
EARLTAFGLELAPLDLREESAKLLEAAAELLRAGGVHPDLLSLPPEAQEALLTEELGSAR
PLLPVGEEPQGEALRVALGSMRAWRDKGAHVVSMTHHPADLLAVFLLAREVGLYRPGRPL
PLDVVPLFETLEDLHRAPEVLRRLLGNPVFRTHAQGRGGVEVMIGYSDSNKDAGFLAANL
ALYEAQEALAQVGREAGLPVFFFHGRGTSTARGGGPAGRAIASLPPRSVGHRLRLTEQGE
ALADRYAHPDLAVRHLEQLLFHFAQAALGEGREPEPAWREALRGAAEESMGRYRALLGQE
GFFPFFEAFTPIREIGELPIASRPVYRHGRVREIRDLRAIPWVMAWTQVRLLLPGWYGLS
ALEGLPLSLLRGMYRGWPFFATTLESAAMALAKADLGVARLYLRLVPEALHPFFHHLAEE
YRKTVALLEAIFEAPLLHNQRTLERQIALRNPYVDPINFVQVELLARYRAPGGREDEGVR
KALLLSLLGVAAGLRNAG
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
ttgaccccggagccctttgaccgcctcagggccgaggtggacctcctgggccgcctcctg
ggggaggccatccgggccgtttccggggagcggatcctcgccctggtggaggaggtgcgc
catctggccaaggcccgccggcagggggaggagggggcgggggaggccctgggccgaagg
gtggagggcctttccctggccgaggccgaggccctggtgcgggccttcacccactacttc
cacctggtgaacctggcggaggagcggcaccgggtgcgggtgaaccgcctgcgggcggag
gcggaaaccctggaaaaccccagacccgagggctttttggccctggccaaggccctgaag
gagcgggggctttccctggaggaggcggaggcccacctgaaccgcctggagcttcacctc
acctttaccgcccaccccacggagacccggcggcgcaccctgcgccaccacctggagcgc
ctgggggaggagctggaagcgggggagaaggagcgcctcctggcccgggtggccctgctc
tatgccaccgaggaggtgcgcaaggcccgcccctcggtggaggacgagatcaaggggggg
ctttactacctgcccaccaccctttggcgggccatcccccgggtggtggcgggcctcgag
gcggccctggaacgggtctatggccggcgtccccgcctccggagcccggtccgcttccgc
agctggatcgggggggaccgggacgggaaccccttcgtcaccccggaggtgacggccttc
gccgcccgctacgcccgccaggtggcccgcgagcggtttttgcaggagctggaggccctg
gtgcgggacctttccctcgccgaggcccgggtccccgtcccgcgggaggtgcgctccggg
ggggagggggtggagcgcttccccggggaggcctaccgccgcttcttcgccggcctttac
gggcgcctggagcgggaggagctcaccacggaagggcttttgcgggccgtgcgcctggcc
gagggggggctggagggggtggggcttggtcccgtggcccgggccttcctccggcccctc
gaggcccgcctgaccgccttcggcctggagcttgcccccttggacctgagggaggagtcc
gccaagctcctggaggcggcggcggagctcctgcgcgcgggtggggtccaccccgacctc
ctctcccttccccctgaggcccaggaggccctcctcaccgaggagctggggagcgcaagg
ccgctccttcccgtgggggaggagccccaaggggaggccctgcgggtggccctggggtcc
atgcgggcctggcgggacaagggggcccacgtggtttccatgacccaccaccccgccgac
ctcttggcggtcttcctcctggcccgggaggtgggcctgtaccgtccgggaaggcccttg
cccttggacgtggtgcccctttttgaaacccttgaggacctgcaccgggccccagaggtc
ctccgccgcctccttggcaacccggtgttccgcacccacgcccagggaaggggcggggtg
gaggtcatgatcggctactccgactccaacaaggatgcgggcttcctggcggccaacctg
gccctatacgaggcccaggaggccctggcccaggtggggcgggaagcggggcttcccgtc
ttcttcttccacggccgggggacctccaccgcccggggcggggggcctgcggggcgggcc
atcgccagccttccccccaggagcgtgggccaccgcctgcgcctcacggagcagggggag
gccctggccgaccgctatgcccaccccgacctggcggtgcgccacctggagcagctcctc
ttccactttgcccaggccgccttgggggaagggcgggagcctgagcccgcctggcgggag
gccctaaggggggcagcggaggagagcatgggccgctacagggccctcctgggccaggag
ggctttttccccttctttgaggccttcacccccatccgcgagatcggggagctgcccatc
gccagccgtcccgtctaccgccatggccgggtgcgggagatccgggacctccgggccatc
ccctgggtcatggcctggacccaggtgcgcctcctcttgcccggttggtatggcctttcc
gccctggagggcctgccgctttccctgctaagggggatgtaccggggctggcccttcttc
gccaccaccctggagagcgcggccatggccctggccaaggccgacctgggggtggcccgg
ctttacctgcgcctggtgcccgaggcccttcaccccttcttccaccatctggccgaggag
taccgcaagacggtggccctcttggaggccatctttgaggccccccttctccacaaccag
cgcaccctggagcggcagatcgccctgcgtaacccctacgtggaccccatcaacttcgtc
caggtggaactcctcgcccgctaccgcgccccggggggccgggaggacgagggggtgcgc
aaggccctcctcctctccctcttgggggtagccgccggcctgaggaacgcgggctag

DBGET integrated database retrieval system