KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_12040Help
Entry
TCCBUS3UF1_12040  CDS       T01866                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00250  Alanine, aspartate and glutamate metabolism
thc00280  Valine, leucine and isoleucine degradation
thc00410  beta-Alanine metabolism
thc00640  Propanoate metabolism
thc00650  Butanoate metabolism
thc01100  Metabolic pathways
thc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:thc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    TCCBUS3UF1_12040
   00650 Butanoate metabolism
    TCCBUS3UF1_12040
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TCCBUS3UF1_12040
   00280 Valine, leucine and isoleucine degradation
    TCCBUS3UF1_12040
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TCCBUS3UF1_12040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:thc01007]
    TCCBUS3UF1_12040
Enzymes [BR:thc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     TCCBUS3UF1_12040
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     TCCBUS3UF1_12040
Amino acid related enzymes [BR:thc01007]
 Aminotransferase (transaminase)
  Class III
   TCCBUS3UF1_12040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEV16248
UniProt: G8NDA7
LinkDB All DBs
Position
1196874..1198175
Genome map
AA seq 433 aa AA seqDB search
MALVESRNQALWQLREQYIPRGVAQAHPIFAARAEGVRIWDVDGKEYLDFAGGIGVMNVG
HGHPRVLQAVRAQLERFTHVAFQVTPYEVYLRLAERLAHLAPGEGPKKTLFLTTGAEAVE
NAVKIARAFTGRPAVVALTHGFHGRTLLGMSLTGKAGYYKQNFGPFAPEVYHAPVPYPYR
GVSEAQALEGLEELFRTQVDPERVAALILEPVLGEGGFIPLSPDYLQAVRRLTQAHGILL
VADEIQSGFGRTGRFWAIQHSGVVPDLLLFAKSVAAGLPLSGVVGRAEVMDAPRPGGLGG
TYAGNPLACAAGLAVLEVFQEEGLLERAQTLGERLWQGLVSLQARFPQVGEVRGLGPMVA
LELVRDPVGKAPAPEAAQRVLEAARARGLILLKAGMYGNVIRVLVPLTAGEEEVQEGLRR
LEGALEEALTEEG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtggccctggtggagtcgcgaaaccaagccctttggcagttgcgggagcagtacatcccc
cggggggtggcccaggcccaccctatcttcgccgcccgggcggagggggttcgcatctgg
gacgtggacggcaaggagtacctggacttcgccgggggcataggggtgatgaacgtgggc
cacgggcatccccgggtcctgcaggcggtccgggcccagctggagcgcttcacccacgtg
gccttccaggtaaccccctacgaggtctacctccgcctggccgagcggctggcccacctg
gcccccggggaaggccccaaaaaaacccttttcctcaccacgggggccgaggcggtggag
aacgcggtgaagatcgcccgggccttcaccggccgcccggcggtggtggccctaacccac
gggttccacgggcgcaccctgctgggcatgtccctcacgggtaaggcgggctactacaag
caaaactttggacctttcgcccccgaggtctaccacgcccccgtgccctacccctaccgg
ggggtttccgaggcccaggctttggagggcctcgaggagctcttccgcacccaggtggat
cccgagcgggtggcggccctcattctggaaccggtcctgggcgagggggggtttatcccc
ctttccccggactacctgcaggcggtgcgccggcttacccaggcccacggcatccttctg
gtagcggacgagatccagtccgggtttggccgcaccggccgcttctgggccatccagcac
agcggggtggtgcccgacctcctcctcttcgccaaaagcgtggccgctgggcttcccctt
tccggggtggtgggccgggccgaggtcatggatgcccccaggcccggggggcttggcggc
acctacgcgggcaaccccctggcctgcgccgccggcctggcggtgctggaggtcttccag
gaggaaggtttgttggagcgggcccagaccttaggggagcgtctttggcagggcctggtc
tccctgcaggcccgctttccccaggtgggggaggtgcggggcctggggcccatggtggcc
ctggagctggttcgggacccggtgggcaaggcgcccgcccctgaggcagcccagcgggtc
ctggaggcggcccgcgcccggggcctcatcctgctcaaggcggggatgtacgggaacgtg
atccgggtgctggtgcccttgacggccggcgaggaggaggtccaggaggggcttcgccgt
ttggaaggggctttggaggaggccttgacggaggaggggtga

DBGET integrated database retrieval system