KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_13890Help
Entry
TCCBUS3UF1_13890  CDS       T01866                                 

Definition
(GenBank) Biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00061  Fatty acid biosynthesis
thc00620  Pyruvate metabolism
thc00640  Propanoate metabolism
thc01100  Metabolic pathways
thc01110  Biosynthesis of secondary metabolites
thc01120  Microbial metabolism in diverse environments
thc01130  Biosynthesis of antibiotics
thc01200  Carbon metabolism
thc01212  Fatty acid metabolism
Module
thc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:thc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TCCBUS3UF1_13890
   00640 Propanoate metabolism
    TCCBUS3UF1_13890
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TCCBUS3UF1_13890
Enzymes [BR:thc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     TCCBUS3UF1_13890
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     TCCBUS3UF1_13890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATP-grasp_4 GARS_A RimK ATPgrasp_YheCD DUF3182 ATPgrasp_ST ATP-grasp_5 LAL_C2 ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: AEV16430
UniProt: G8N7W3
LinkDB All DBs
Position
complement(1379724..1381061)
Genome map
AA seq 445 aa AA seqDB search
MRKVLIANRGEIALRIIRAAKELGLKTVVAHSTADEKSLPVLLADEAICIGPPPSGQSYL
NIPNLLSAAIVTGADAIHPGYGFLAENATFAEMCREHGITFIGPTPENMRALGDKATARK
VAREAGVPTVPGTDELQGVEEAKRAAAEIGYPVILKASAGGGGRGMRVVHTEEELERAIQ
QAQEEARAAFGNPAVYLEKYIEEPKHIEIQVLGDGENVIHLWERDCSIQRRHQKLLEEAP
SVLPLETRKAIAEAAARLARHVGYVSAGTLEFLVDKEGNFYFIEMNTRIQVEHPITEMIT
GVDLVQAQFRIAQGEKLWLKQEDIGVRGHAIEVRINAEDPEKGFRPSIGKVETLLFPGGP
GIRVDSHLYAGYQIPPHYDSLIAKVIAWAPTREEAIRRMERALSETVIEGPGLKTTIPFH
QKVLQNAFFRRGAVYTNFVARRMEL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggtcctgattgccaaccgcggcgagatcgccctcaggatcatccgggccgcc
aaggaactgggcctcaaaaccgtggtggcccactccaccgccgacgagaagagcctgccc
gtcctcctggcggacgaggccatctgcatcgggccgcccccttcggggcagagctacctc
aacatccccaacctcctttccgcggccatcgtgaccggggcggacgccatccaccccggc
tacggcttcctggcggaaaacgccaccttcgccgagatgtgccgcgagcacggcatcacc
ttcatcggtcctaccccggagaacatgcgggccctgggcgacaaggccacggcccggaag
gtggcccgggaggccggggtgcccacggtgccgggcacggacgagcttcagggcgtggag
gaggccaagcgggcggccgcggagatcggctaccccgtgatcctcaaggcttccgccggg
ggtgggggccgggggatgcgggtggtgcacaccgaggaggagttggagcgggccatccag
caggcccaggaggaggcccgggccgcctttggcaaccccgcggtctacctggagaagtac
attgaggagcccaagcacatcgagatccaggtcctgggggatggggagaacgtcatccac
ctttgggagcgggactgctccatccaaaggcggcaccagaagctcttggaggaagccccc
agcgtcctccccttggaaacccgcaaggccatcgccgaggccgcggcccgcctggcccgg
cacgtgggctacgtgtccgcgggcaccctggagttcttggtggacaaggaggggaacttc
tacttcatcgagatgaacacccgcatccaggtggagcaccccatcacggagatgatcacc
ggcgtggacctggtccaggcccagttccgcatcgcccagggggagaagctttggctcaag
caggaggatatcggggtccggggccacgccattgaggtgcgcatcaacgccgaggaccca
gagaagggctttaggccctccatcggcaaggtggagaccctgcttttcccgggtggcccc
ggcatccgggtggacagccacctctacgcgggctaccagatcccgccccactacgacagc
ctcatcgccaaggtcatcgcctgggcccccacccgggaggaggccatacggcggatggag
cgggccctttccgagacggtgatcgaggggccggggctcaagaccaccatccccttccac
cagaaggtcctgcaaaacgccttcttccgccggggggcggtctacaccaacttcgtggcc
cggcgcatggagttgtag

DBGET integrated database retrieval system