KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_8010Help
Entry
TCCBUS3UF1_8010   CDS       T01866                                 

Definition
(GenBank) Malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00020  Citrate cycle (TCA cycle)
thc00270  Cysteine and methionine metabolism
thc00620  Pyruvate metabolism
thc00630  Glyoxylate and dicarboxylate metabolism
thc00680  Methane metabolism
thc00710  Carbon fixation in photosynthetic organisms
thc01100  Metabolic pathways
thc01110  Biosynthesis of secondary metabolites
thc01120  Microbial metabolism in diverse environments
thc01130  Biosynthesis of antibiotics
thc01200  Carbon metabolism
Module
thc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
thc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
thc_M00012  Glyoxylate cycle
thc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TCCBUS3UF1_8010
   00620 Pyruvate metabolism
    TCCBUS3UF1_8010
   00630 Glyoxylate and dicarboxylate metabolism
    TCCBUS3UF1_8010
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TCCBUS3UF1_8010
   00680 Methane metabolism
    TCCBUS3UF1_8010
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TCCBUS3UF1_8010
Enzymes [BR:thc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     TCCBUS3UF1_8010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: AEV15849
UniProt: G8NBF9
LinkDB All DBs
Position
complement(781140..782123)
Genome map
AA seq 327 aa AA seqDB search
MKSPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPIILQLLEIPQALRALEGVIMELEDC
AFPLLQGLVATDDPKVAFKDADYALLVGAAPRKAGMERRDLLEMNGKIFTEQGRALAEVA
KRDVKVLVVGNPANTNALIAYKNAPGLNPRNFTAMTRLDHNRAKAQLAKKTGVPVGRIRR
IAVWGNHSSTMFPDLFHAEVEGQPALERVGMEWYEKEFIPTVAQRGAAIIQARGASSAAS
AANAAIEHIRDWALGTPEGDWVSMAVPSQGEYGIPEGIVYSFPVTAQGGEYRIVEGLEVN
AFARKRMEITAQELLEEMEQVKALGLI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagccctgttcgcgtggccgtcaccggcgctgcaggccagattggctacagcctt
ctcttccgcatcgccgcgggggagatgctgggcaaggaccagcccatcatcctccagctt
ctggaaatcccccaggccctgagagccctggaaggggtgatcatggagctggaagactgc
gccttccccctcctccagggcctggtggccaccgatgaccccaaggtggccttcaaggat
gccgactacgcccttctggtgggggccgccccccgcaaggcggggatggagcgccgggac
cttttggagatgaacggcaagatcttcaccgagcagggccgggccctggccgaggtggcc
aagcgggacgtgaaggtcctggtggtgggcaaccccgccaacaccaacgccctcatcgcc
tacaagaacgccccgggcctcaacccccggaacttcaccgccatgacccggctggaccac
aaccgggccaaggcccagctggccaagaagacgggggttcccgtgggccgcatccgccgc
atcgccgtctggggcaaccactcctccaccatgttccccgacctcttccacgccgaggtg
gaggggcagccggccctggagcgggtggggatggagtggtacgagaaggagttcatcccc
accgtggcccagcggggggcggccatcatccaagcccggggggcctccagcgccgccagc
gccgccaacgccgccattgagcacatccgcgactgggccctgggcaccccggaaggggac
tgggtctccatggccgtgccctcccaaggggagtacggcatccccgaggggatcgtctac
tccttccccgtcacggcccagggcggggagtaccggatcgtggagggcctcgaggtcaac
gccttcgcccgcaagcggatggagatcacggcccaagagctcctggaggagatggaacag
gtgaaggccctaggcctcatctaa

DBGET integrated database retrieval system