KEGG   Candidatus Tokpelaia hoelldoblerii: BHV28_04700Help
Entry
BHV28_04700       CDS       T04701                                 

Definition
(GenBank) Anthranilate synthase
  KO
K13503  anthranilate synthase [EC:4.1.3.27]
Organism
thd  Candidatus Tokpelaia hoelldoblerii
Pathway
thd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
thd01100  Metabolic pathways
thd01110  Biosynthesis of secondary metabolites
thd01130  Biosynthesis of antibiotics
thd01230  Biosynthesis of amino acids
Module
thd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:thd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BHV28_04700
Enzymes [BR:thd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     BHV28_04700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind GATase Peptidase_C26 Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AQS41182
UniProt: A0A1U9JTJ5
LinkDB All DBs
Position
complement(494925..497090)
Genome map
AA seq 721 aa AA seqDB search
MIQTAQITDYETAGGISIRRQRENIAYDSAIERMVAALDSRRGAVLSSNYEYPGRYTRWD
TGIIDPPLCITAHGRRMTFEALNNRGEIVLAAIFPVVEALEPVTVTSHTATRLGLDIART
DGSFTEEERSRIPSVFTVLRAIVKLFFSSEDDNLGLFGAFGYDLAFQFEPVELTIPRPAD
QRDLVLYLPDSILVVDHHAAQAWIDRYDFTCGDTSTTGLPRETAAEPFRRSDTTPPRGDH
QHGEYARGVAAAKEKFKRGDLFEVVPGQTFYAPCTTSPAAIAKTLKQMNPSPYSFFFNLG
EQEYLVGASPEMFVRVSGRRVETCPISGTIKRGEDAIADSEQILKLLNSKKDESELTMCS
DVDRNDKSRICEPGSVRVIGRRQIEMYSRLIHTVDHIEGRLREGMDAFDAFLSHAWAVTV
TGAPKLWAMRFIENHEKSPRNWYGGAVGMMHFNGNMNTGLTLRTIRIKDGVAAVRAGATL
LYDSDPQEEEAETELKASAMLTAIATSGADVPPTNTAQTSQAGAGRHILLVDHEDSFVHT
LANYFRQTGAYVTTLRSPVAEETFDSLKPDLVVLSPGPGSPQDFDCTATITKARRRNIPV
FGVCLGLQALVEAYGGTLKQLERPMHGKPSRIRIIKAGTVFAGLPQEVTVGRYHSLFTDR
DHLPETLTITAESEDGVIMAVEHKSEPVAAVQFHPESIMTLGGNAGMRMLENVVKRLTNR
Q
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaaccgcacaaataaccgattatgaaaccgccggcggcatcagcatccgccgt
cagcgggaaaacatcgcctatgacagcgcgattgagcgcatggttgccgcgctcgacagc
cgccgcggcgcggttctgtcctcaaattatgaatatcccgggcgttatacccgctgggat
acgggcattatcgacccgccactctgcatcactgcacacgggcggcgaatgacttttgag
gcgttgaacaaccgcggtgaaattgtgctggcagcaatttttccagtcgtcgaagcgctt
gaaccggtaaccgtcaccagccacaccgcgacgcggctgggccttgatattgcccggacg
gacggttctttcacggaagaggagcgctcgcgcattccttccgtattcactgtcctgcgg
gccatcgtcaagctgtttttttcatctgaagatgacaatcttggcctgttcggcgctttc
ggctatgaccttgcctttcagtttgaaccggtcgagctgacaatcccccgccccgccgac
cagcgcgatctggtgctgtatctgcctgattccattctggtggtggaccatcatgcggcg
caagcctggattgaccgttatgatttcacctgcggcgatacttcaacaacaggcctgcca
cgggaaaccgctgccgagccgttccgccgcagcgatacaaccccgccgcgcggcgatcat
caacatggcgaatatgcccgcggcgtggcagcagccaaggaaaaattcaaacgcggcgac
ctgttcgaggttgtgcccggacagacattttacgccccttgcaccacaagccccgccgcc
attgccaaaaccctgaaacagatgaacccttcaccctattcgttctttttcaacctgggt
gaacaggaatatctggttggcgcttcaccggaaatgtttgtgcgtgtttcggggcgccgt
gtcgagacctgcccgatttccggcactatcaagcgcggcgaagatgccattgccgattct
gaacagattttaaagctgctcaactccaaaaaggatgaatcagaactgacgatgtgttcg
gatgttgaccgtaatgacaaaagccgcatttgtgagccaggttccgtgcgtgttatcggg
cggcggcagattgagatgtattcccgccttatccacacggttgaccatattgaagggcgt
ttgcgcgaaggcatggatgcttttgacgcatttctttcccacgcatgggcggtgacagtc
accggcgcacccaaattatgggccatgcgctttattgaaaaccatgaaaaaagcccgcgc
aactggtatggcggcgctgtcggcatgatgcatttcaatggcaatatgaacaccggcctg
acattacgcaccatccgcatcaaggatggcgttgccgcggtgcgggcaggcgctaccctg
ctttatgattccgatccgcaggaagaagaggcggaaaccgaactgaaagcatccgccatg
ctgactgctattgcgacaagcggcgcagacgttccgccgacaaacaccgcgcaaacatcc
caggccggagccgggcgtcatatcctgctcgtggaccatgaagattcttttgtgcataca
ctggccaattatttccgccagacgggcgcatacgttaccacattacgcagccccgttgcg
gaagaaacctttgacagcctcaagcctgaccttgtcgtgctttccccggggcccggctca
ccgcaggattttgactgcaccgccacgattacaaaagcacgccggcgcaatattccggtt
ttcggggtttgcctcgggttgcaggcccttgttgaagcctatggcggcacactcaaacaa
ctggaacgccccatgcacggcaagccgtcacgtatccgcattatcaaagccggtacagtg
tttgccggtctgccgcaagaggtgacggttggccgttatcattcgctgtttaccgaccgc
gaccatctgcctgaaacactaactatcacggccgaaagtgaagacggagtgattatggcg
gtggaacacaaaagcgaaccggtggcggcagtgcagtttcacccggaatccatcatgacg
cttggcggcaatgccggcatgcggatgctggaaaatgtggtaaagcggttgacaaaccgg
caataa

DBGET integrated database retrieval system