KEGG   Candidatus Tokpelaia hoelldoblerii: BHV28_10970Help
Entry
BHV28_10970       CDS       T04701                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
thd  Candidatus Tokpelaia hoelldoblerii
Pathway
thd00250  Alanine, aspartate and glutamate metabolism
thd00410  beta-Alanine metabolism
thd00640  Propanoate metabolism
thd00650  Butanoate metabolism
thd01100  Metabolic pathways
thd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:thd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BHV28_10970
   00650 Butanoate metabolism
    BHV28_10970
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BHV28_10970
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BHV28_10970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:thd01007]
    BHV28_10970
Enzymes [BR:thd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BHV28_10970
Amino acid related enzymes [BR:thd01007]
 Aminotransferase (transaminase)
  Class III
   BHV28_10970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AQS41785
UniProt: A0A1U9JV77
LinkDB All DBs
Position
complement(1155270..1156550)
Genome map
AA seq 426 aa AA seqDB search
MLNQEIANRRTDAVARGVGVNTQVYVERARNSEVWDVEGRRYIDFAAGIAVVNTGHCHPR
VIEAAKKQLEHFTHTCHQVVPYENYVALAERLNRLVPGDFEKKTLFVTTGAEAVENAVKV
ARAATGRSAVIAFTGGFHGRTFMGMALTGKVQPYKADFGPLMPDVYHIPFPVELHGISVE
ATLASLEKLFKADVAPKRVAAFIVEPVQGEGGFYEVPKALFAALRKCADEHGIVLIADEV
QTGFARTGKLFAMENQEITADITAMAKGLGGGFPLAAVTGRADLMDAAAPGGLGGTYGGN
PVAVAAAHAVLDVIEEENLCERASLLGARLKQRLQSMREDVPQIADIRGLGFMVAVEFNK
PDSDEPSAAFTEQVRKKALEKGLILLTCGVYGNVVRFLAPITIDDKIFSEALDILEDTLT
ECAREV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatcaggaaattgcaaatcgccgcaccgatgctgtcgcgcgcggtgtcggggtt
aatacgcaggtctatgttgaacgggcgcggaattctgaagtctgggatgtggagggccgg
cgttatattgattttgcggcaggcattgcggtggtgaataccgggcactgccatccccgt
gtgattgaagcggccaaaaaacagcttgagcatttcacccatacctgccatcaggttgtc
ccttatgaaaattatgttgctctggctgaacgcctgaacaggcttgttccgggcgatttt
gagaaaaaaacactgtttgtcaccaccggtgccgaagcggtggaaaatgccgtcaaggtt
gcgcgcgccgctacggggcgttctgctgttatcgccttcaccggcggttttcacggacgg
acattcatgggcatggcgcttaccggaaaagtgcagccctacaaggcagatttcgggccg
ttgatgccggatgtctatcatattccttttccggttgagctgcatggaatcagtgttgag
gccacgcttgccagtttggaaaaactgttcaaggcggatgttgccccgaagcgggtggcg
gcttttattgttgagccggtgcagggcgaaggcggtttttatgaagtgccgaaagcgctg
tttgcagccttgcgcaagtgtgccgacgaacatggtattgtgctgattgccgatgaagtg
cagacaggctttgcccgcacagggaaactgtttgcgatggaaaatcaggagattaccgct
gatattaccgcaatggcgaagggcttgggcggcggtttcccgcttgcggcggtgacaggg
cgggcggatctgatggatgcggcggcccccggcgggctcggcggcacgtatggcggcaac
cccgtggcggttgcggcggcgcacgcggtgcttgatgtgattgaggaagaaaacctgtgc
gagcgtgcgtccttgcttggtgcgcggttgaaacagcgtttgcagtccatgcgggaggat
gtgccgcagattgctgatattcgcgggctgggcttcatggtggcggttgaatttaataag
ccggattctgatgaaccgagtgcggcctttactgagcaggtgcgtaaaaaagccctggaa
aaggggctgattttgctcacctgcggtgtctatggcaacgttgtgcgttttcttgcgccg
attaccattgatgataaaatttttagtgaagcgcttgatattcttgaagacactctgaca
gaatgtgccagagaggtataa

DBGET integrated database retrieval system