KEGG   Candidatus Tokpelaia hoelldoblerii: BHV28_13210Help
Entry
BHV28_13210       CDS       T04701                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
thd  Candidatus Tokpelaia hoelldoblerii
Pathway
thd00471  D-Glutamine and D-glutamate metabolism
thd00550  Peptidoglycan biosynthesis
thd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BHV28_13210 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BHV28_13210 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:thd01011]
    BHV28_13210 (murC)
Enzymes [BR:thd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     BHV28_13210 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:thd01011]
 Precursor biosynthesis
  Amino acid ligase
   BHV28_13210 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AQS42004
UniProt: A0A1U9JVU8
LinkDB All DBs
Position
complement(1410086..1411495)
Genome map
AA seq 469 aa AA seqDB search
MKMPLDVGLIHFIGIGGIGMSGIAEVLHNLGYKVQGSDQADNANVVRLREKGIEVFIGHD
AANLGAAEVVVISTAIRKDNPEYKAAREKFLPIVRRAEMLAELMRFRQAVAVGGTHGKTT
TTSLIGTLLEAGGFDPTVINGGIINAYGTNARMGAGDWMVVEADESDGTFLKLPADIAVI
TNIDPEHLDHYGNFDGVREAFRQFVENVPFYGFGVMCLDHPEVQALVGRISDRRVVTYGA
NPQADVRFLNHRMEGPRSHFDVIIRNRKTGVTVEMKNLVLPMPGLHNVSNACAAIAVAHE
LGVSDEAMARGLAGFGGVKRRFTHTGSWKGIEFFDDYGHHPVEIRAVLKAAREAAPGKVI
AIMQPHRFSRLHDLFDEFATCFNDADMIAVAPVYAAGEEPVPKVNSKMLVERIQTAGHRD
ACYINGPEAIAPLVRNMARKGDYVVFLGAGNITQWAYSVPQELAEKKKK
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgccacttgatgtcggtcttattcattttatcggcataggtggtattggtatg
agcggtattgccgaggtgctgcataatcttggctacaaggtgcagggctcggaccaggcg
gacaatgccaatgttgtgcggctgcgtgaaaagggcatagaggtttttatcggccacgac
gcggccaatctgggcgcggcggaagtggtggtgatttccaccgccatccgcaaggataat
cctgaatacaaggcggcgcgggaaaaatttctgccgattgtgcgccgcgctgaaatgctg
gccgagctgatgcgtttccgtcaggcggtggcggttggcggcacccacggcaaaaccacg
acaacctcgctgatcggcaccctgcttgaggccggcggctttgaccctacggtgatcaat
ggcggcattatcaatgcctatggcaccaatgcgcgcatgggggcgggagactggatggtg
gtggaagcggatgaaagcgacggcacgtttttgaaactgcccgctgatattgctgttatc
accaatatcgatccggaacatcttgaccattatggcaattttgacggcgtgcgcgaagcg
ttccgtcagtttgtcgagaatgtgccgttttacggctttggcgtgatgtgccttgaccac
ccggaagtgcaggcgcttgtcgggcgtatcagtgaccggcgtgtggtgacctatggcgcc
aaccctcaggctgatgtgcggtttttgaaccaccggatggaaggcccgcgctcacatttc
gatgtgattatccgcaaccgcaaaaccggtgtgacggtagagatgaaaaatcttgtgctg
cccatgcccgggctgcataatgtcagcaatgcttgcgccgcgattgccgttgcccatgaa
ctgggcgtatcggatgaggcgatggcgcgcgggcttgcgggctttggcggtgtcaagcgc
cggttcacccatacaggttcatggaaggggatagaattctttgatgattacggccatcat
ccggttgaaatccgtgcggttttaaaagccgcgcgggaagcggccccgggcaaggtgatc
gccattatgcagccgcaccgtttcagccgcctgcatgatctgtttgatgaatttgccacc
tgtttcaatgatgcggatatgattgctgtcgcgccggtttatgctgccggtgaagaaccg
gtgccaaaggtgaattccaaaatgctggttgagcgtatccagactgccgggcaccgcgac
gcgtgctatatcaacgggccggaggcaatcgcgccgctggtgcgtaatatggcgcgaaag
ggggattatgtggtgttcctgggtgcgggcaatatcacgcaatgggcgtacagtgttccg
caggaactggcggagaagaagaaaaaatga

DBGET integrated database retrieval system