KEGG   Thermococcus sp. 4557: GQS_10630Help
Entry
GQS_10630         CDS       T01588                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
the  Thermococcus sp. 4557
Pathway
the00620  Pyruvate metabolism
the00680  Methane metabolism
the00720  Carbon fixation pathways in prokaryotes
the01100  Metabolic pathways
the01120  Microbial metabolism in diverse environments
the01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:the00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GQS_10630
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    GQS_10630
   00680 Methane metabolism
    GQS_10630
Enzymes [BR:the01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GQS_10630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AEK74019
UniProt: G0HPP9
LinkDB All DBs
Position
1993317..1994741
Genome map
AA seq 474 aa AA seqDB search
MIPRTMSTQHPDNVFIPFFAGSPTMGGEDEVIEAFYAFSVLGIDEQMWDFEGKEVDEFVV
KKLFERYGYFFKRKKLGEELRLTPRVPNPSVERAEAKLLLETLEAIPRSADYARLFYGEE
LPPIFEVILPMTTSSQELNRVYELYRHYIAGKQYKRVHDIKLHEWIGEFYPSEIGVIPLF
ESREAILSAADIVREYLGGKEVEYQRVFLARSDPAMNYGLISAVLYDKLALFELQGLEEE
LGIPIYPIIGVGGAPFRGHFTPENVEGVLAEYPSVQTFTIQSSFKYDRTPKDVIRAVERI
RESKRGKALPVPEEAFEILKKYEARYSEELRALAPFIREVAKFVPSRRRRKLHIGLFGYS
REVNGSALPRAIKFTASLYSLGIPPELLGLSALSEKELEFLGDYYLDLYRDIEFAFRYFN
PKAAERFPFLKPLAKMARDYERDERHGEITSRILAGELSSELIVEAAGIRGFLG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgataccaagaacgatgagcactcagcatcctgacaacgtgttcattccctttttcgcg
ggcagtccgacgatgggcggtgaagatgaggtcatcgaggctttctacgccttcagcgtc
ctggggatagacgagcagatgtgggacttcgagggcaaggaggttgacgagttcgtcgtc
aagaagctattcgagcgctatggctatttcttcaagcgcaaaaagctcggggaagaactc
agactgacgccgcgcgtccccaaccccagcgtcgagagggccgaggcgaagctcctcctt
gagaccctggaggcgataccccgctcggcggactacgcgaggctgttctacggtgaagag
cttccgccgatatttgaggttatcctccctatgacaacctcctcccaggaactgaacagg
gtttacgagctctacagacactacatagccggaaagcagtacaagagggtccacgacatc
aagctccacgagtggataggggagttctatccctcggagataggtgtcatcccgctcttc
gagagcagggaggcgatactgagcgcggcggacatcgtgcgggagtacctcggcgggaag
gaggtcgaatatcagcgcgtttttctcgcgaggagcgaccccgcgatgaactacggcctc
ataagcgcggtgctctacgacaagctggcgctcttcgaacttcagggactcgaggaggaa
ctcgggattccaatctatccgataatcggcgtcggcggtgcgccgttcagggggcacttc
acccccgagaacgtcgagggggttctggccgaatatccgagcgtccagactttcacgata
cagagttcgttcaagtacgacaggacgccgaaggacgtcataagggcagttgagcggatc
agggaatcgaagaggggaaaagccctgcccgttccggaggaggcgtttgaaatcctcaag
aagtacgaggccagatactcggaggagctcagggcgcttgctcccttcatcagggaggtc
gcaaagttcgtcccatcgaggagacggaggaagctccacatcggcctcttcggctactct
cgcgaggtgaacggctcggccctgccgagggcgataaaattcacggcctcactctactcc
ctcggaatcccgccggagctcctcggccttagtgcactgagcgagaaggagctcgaattc
ctcggcgactactacctggacctttatcgggacatcgagtttgccttccgatacttcaac
cccaaggctgccgagaggtttccgttccttaaaccgctcgcgaagatggcaagggactac
gagcgggacgaaaggcacggcgagataacctcaaggatactggccggagagctgagcagt
gagctgatagttgaggcggcggggattcggggatttttgggataa

DBGET integrated database retrieval system