KEGG   Thermosynechococcus sp. CL-1: FFX45_09700
Entry
FFX45_09700       CDS       T06232                                 

Definition
(GenBank) 2-oxo acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
thec  Thermosynechococcus sp. CL-1
Pathway
thec00010  Glycolysis / Gluconeogenesis
thec00020  Citrate cycle (TCA cycle)
thec00620  Pyruvate metabolism
thec01100  Metabolic pathways
thec01110  Biosynthesis of secondary metabolites
thec01120  Microbial metabolism in diverse environments
thec01200  Carbon metabolism
Module
thec_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FFX45_09700
   00020 Citrate cycle (TCA cycle)
    FFX45_09700
   00620 Pyruvate metabolism
    FFX45_09700
Enzymes [BR:thec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FFX45_09700
SSDB
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl ATP-grasp MadL AATase
Other DBs
NCBI-ProteinID: QEQ01624
UniProt: A0A5C2M808
LinkDB
Position
complement(1970641..1971927)
AA seq 428 aa
MIRELFMPALSSTMTEGKIVSWVKSPGDKVAKGETVLIVESDKADMDVESFYDGYLAVIT
VPAGEVAPVGSTIGLVAETEAEIAEAEAKAKSLGAATSSTTSSAATASTPAAATSNGSAT
APVAVASPTSAVAATTGRVVASPRARKLAKEHKIDLQTLKGTGPNGRITAADVEALIGAP
ATPVTPVATPPVPTAPPATAPVVVKEDLVPLTTLQNAVVRNMVASLGIPDFHVAYTITTD
ALDRLYQQIKSKGVTMTALLAKAIALTLQKHPIMNAYYTEQGIQYRRDINIAVAVAMPGG
GLITPVLKNADQVDIYSLSRTWKELVERARAKQLQPEEYSTGTFSLSNLGMFGVDFFDAI
LTPGQGAIMAVGASRPTVVATEDGLLGVKRQMKVNITCDHRVIYGADAAAFLQDLAKLIE
TNPQALTL
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgattcgtgaactgttcatgcccgccctcagctccaccatgaccgaagggaaaattgtc
tcttgggtgaaatctcccggggataaggtggccaagggggaaaccgtgctgattgtggaa
tccgacaaggccgatatggatgtggagtccttctacgacggctatttggcggtgattacc
gtgcctgctggcgaagtggcacccgtcggttccaccattggcctcgtggcagaaacagaa
gcagaaattgcggaagcagaggcaaaggccaagtcccttggggcggcgaccagttctacg
acgagttctgcagcaacggcctcgactcccgctgcggccacaagtaatggctccgcaacg
gctcctgtggcagtggcttctcccaccagtgctgttgctgcaactactgggcgagtggtt
gcttccccccgtgcccgcaaattggccaaggaacacaaaattgatttgcagacgctcaag
ggaacgggtcccaatggtcggattaccgccgctgatgtggaagccttgattggtgcgcct
gcaactcccgttacaccagtagcgacaccccctgtccccacagccccccctgcgactgcc
ccggtcgtcgtcaaagaggatctggtgcccctgacaacgctacaaaatgcggtggtgcgg
aatatggtggccagccttggcattcccgatttccacgtggcctacacgattacaacggat
gcgttggatcggctgtaccagcaaatcaagtcaaaaggggtgacaatgacggcgctcctt
gccaaggcgatcgccctgacgctgcaaaaacacccgatcatgaatgcctattacacggag
caagggattcaataccgtcgcgacattaacattgctgtggctgtggcgatgccggggggt
ggcctgattacaccggtgctgaagaacgccgaccaagttgacatctacagcctctcgcgc
acttggaaagaattagtggagcgggcgcgcgccaagcaactgcaacctgaggagtacagc
acgggtacctttagtctctccaatttaggaatgttcggggttgacttcttcgacgccatt
ctcacccccggtcaaggagccattatggcggtgggggcgtcgcgtccgacggtagttgcc
accgaggatggcctgctgggggtgaaacggcagatgaaggtgaatatcacctgtgatcac
cgtgtgatctatggtgccgatgctgccgctttccttcaggatttggcgaaactgattgaa
accaatccccaagccttgacgctctaa

DBGET integrated database retrieval system