KEGG   Thermosynechococcus sp. CL-1: FFX45_09700Help
Entry
FFX45_09700       CDS       T06232                                 

Definition
(GenBank) 2-oxo acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
thec  Thermosynechococcus sp. CL-1
Pathway
thec00010  Glycolysis / Gluconeogenesis
thec00020  Citrate cycle (TCA cycle)
thec00620  Pyruvate metabolism
thec01100  Metabolic pathways
thec01110  Biosynthesis of secondary metabolites
thec01120  Microbial metabolism in diverse environments
thec01130  Biosynthesis of antibiotics
thec01200  Carbon metabolism
Module
thec_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FFX45_09700
   00020 Citrate cycle (TCA cycle)
    FFX45_09700
   00620 Pyruvate metabolism
    FFX45_09700
Enzymes [BR:thec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FFX45_09700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl ATP-grasp MadL AATase
Motif
Other DBs
NCBI-ProteinID: QEQ01624
UniProt: A0A5C2M808
LinkDB All DBs
Position
complement(1970641..1971927)
Genome map
AA seq 428 aa AA seqDB search
MIRELFMPALSSTMTEGKIVSWVKSPGDKVAKGETVLIVESDKADMDVESFYDGYLAVIT
VPAGEVAPVGSTIGLVAETEAEIAEAEAKAKSLGAATSSTTSSAATASTPAAATSNGSAT
APVAVASPTSAVAATTGRVVASPRARKLAKEHKIDLQTLKGTGPNGRITAADVEALIGAP
ATPVTPVATPPVPTAPPATAPVVVKEDLVPLTTLQNAVVRNMVASLGIPDFHVAYTITTD
ALDRLYQQIKSKGVTMTALLAKAIALTLQKHPIMNAYYTEQGIQYRRDINIAVAVAMPGG
GLITPVLKNADQVDIYSLSRTWKELVERARAKQLQPEEYSTGTFSLSNLGMFGVDFFDAI
LTPGQGAIMAVGASRPTVVATEDGLLGVKRQMKVNITCDHRVIYGADAAAFLQDLAKLIE
TNPQALTL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtgaactgttcatgcccgccctcagctccaccatgaccgaagggaaaattgtc
tcttgggtgaaatctcccggggataaggtggccaagggggaaaccgtgctgattgtggaa
tccgacaaggccgatatggatgtggagtccttctacgacggctatttggcggtgattacc
gtgcctgctggcgaagtggcacccgtcggttccaccattggcctcgtggcagaaacagaa
gcagaaattgcggaagcagaggcaaaggccaagtcccttggggcggcgaccagttctacg
acgagttctgcagcaacggcctcgactcccgctgcggccacaagtaatggctccgcaacg
gctcctgtggcagtggcttctcccaccagtgctgttgctgcaactactgggcgagtggtt
gcttccccccgtgcccgcaaattggccaaggaacacaaaattgatttgcagacgctcaag
ggaacgggtcccaatggtcggattaccgccgctgatgtggaagccttgattggtgcgcct
gcaactcccgttacaccagtagcgacaccccctgtccccacagccccccctgcgactgcc
ccggtcgtcgtcaaagaggatctggtgcccctgacaacgctacaaaatgcggtggtgcgg
aatatggtggccagccttggcattcccgatttccacgtggcctacacgattacaacggat
gcgttggatcggctgtaccagcaaatcaagtcaaaaggggtgacaatgacggcgctcctt
gccaaggcgatcgccctgacgctgcaaaaacacccgatcatgaatgcctattacacggag
caagggattcaataccgtcgcgacattaacattgctgtggctgtggcgatgccggggggt
ggcctgattacaccggtgctgaagaacgccgaccaagttgacatctacagcctctcgcgc
acttggaaagaattagtggagcgggcgcgcgccaagcaactgcaacctgaggagtacagc
acgggtacctttagtctctccaatttaggaatgttcggggttgacttcttcgacgccatt
ctcacccccggtcaaggagccattatggcggtgggggcgtcgcgtccgacggtagttgcc
accgaggatggcctgctgggggtgaaacggcagatgaaggtgaatatcacctgtgatcac
cgtgtgatctatggtgccgatgctgccgctttccttcaggatttggcgaaactgattgaa
accaatccccaagccttgacgctctaa

DBGET integrated database retrieval system