KEGG   Thermaerobacter sp. FW80: E1B22_10200Help
Entry
E1B22_10200       CDS       T05930                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
thef  Thermaerobacter sp. FW80
Pathway
thef00061  Fatty acid biosynthesis
thef00780  Biotin metabolism
thef01100  Metabolic pathways
thef01130  Biosynthesis of antibiotics
thef01212  Fatty acid metabolism
Module
thef_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:thef00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    E1B22_10200
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    E1B22_10200
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    E1B22_10200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:thef01004]
    E1B22_10200
Enzymes [BR:thef01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     E1B22_10200
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     E1B22_10200
Lipid biosynthesis proteins [BR:thef01004]
 Fatty acid synthase
  Component type
   E1B22_10200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: QBS38068
UniProt: A0A4P7GUX3
LinkDB All DBs
Position
2445040..2445828
Genome map
AA seq 262 aa AA seqDB search
MATTVPAGLLEGKRALVFGVANKHSIAWAIARALDAAGAELAIAYQDQRLGERVQKLVPE
LRRPPLLLECDVAFDPQIDAAFATVARHWDRLDVLVHSLAYAPKQALENPFVETTREDFR
IALDVSAYSLVALARAARPLMKEGGSILTMTYYGAQKAVPNYNVMGVAKAALEACVRYLA
ADLGPAGIRVNAISAGPINTLAARGVRNLTDFIKTHAERSALRRNVTQEDVAHAALFLAS
DLAASITGEVLFVDAGYNVMGV
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacgacggttcccgccggcctcctggaaggcaagcgggccctggtcttcggggtg
gccaacaagcacagcatcgcctgggccatcgcccgcgccctggatgcggcgggggcggag
ctggccatcgcctaccaggaccagcggctgggcgagcgggtccagaagctggttcccgag
ctccggcgcccgcccctgctcctggagtgcgacgtcgcgttcgacccgcagatcgacgcg
gccttcgccaccgtggcccggcactgggaccggctggacgtgctggtccacagcctggcc
tatgctcccaagcaggccctggagaaccccttcgtggagaccacgcgcgaggacttccgc
atcgccctcgacgtgagcgcctactcgctggtggcgctggcccgggcggcgcggccgctg
atgaaggagggcggctccatcctgaccatgacctactacggcgcccagaaggcggtgccc
aactacaacgtgatgggcgtcgccaaggcggcgctggaggcgtgcgtccgctacctggcg
gcggacctgggtccggcgggcatccgggtcaacgccatctcggccggccccatcaacacc
ctggccgcccgcggcgtgcgcaacctgacggacttcatcaagacccacgcggaacgctcg
gccctgcggcgcaacgtcacccaggaggacgtcgcccacgccgccctgttcctggccagc
gacctggcggccagcatcaccggcgaggtgctgttcgtcgacgcggggtacaacgtgatg
ggcgtgtga

DBGET integrated database retrieval system