KEGG   Thermomonas sp. HDW16: G7079_11585Help
Entry
G7079_11585       CDS       T06498                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
theh  Thermomonas sp. HDW16
Brite
KEGG Orthology (KO) [BR:theh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    G7079_11585 (ahpF)
Enzymes [BR:theh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     G7079_11585 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 DAO FAD_oxidored FAD_binding_3 HI0933_like Thioredoxin_3 Thi4 AlaDh_PNT_C NAD_binding_8 Glutaredoxin K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: QIL21320
LinkDB All DBs
Position
2435881..2437470
Genome map
AA seq 529 aa AA seqDB search
MLDADLKPQLAAYLEKLQQPIELVASLDASDAARELDVLLDEIAALSPKISRVTGDDARK
PSFLIRRAGSDVQVGFAGIPLGHEFTSLVLALLQVGGHPVKIDEALAEQVRALDGDYAFE
TYMSLHCQSCPDTVQALNAMSVLNPRIKHVAIDGSLFQAEVEAREILSVPTIYLNGAEFD
AGRMSIEQILAKLDTGAVARTAQVLNEAAPFDVLIVGGGPAGAAAAIYAARKGIRTGIVT
ERFGGQVLDTMAIENFPSVEYTEGPKLAASLEAHVRSYGVEIMTAQRAKALQPAAQTGGL
IGIELESGATLHAKTVILSPGARWRQTGVPGESEHRNKGVTYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVDHVTVLEFDGQLRADDVLQRKLHSLPNTTVHVNAQTTEMVGDGG
RLTGLRFTDRTNGQPSDLELAGVFVQIGLLPNTDWLKGTVALSPRGEIAIDDKGHTDVPG
VFAAGDATTEPFKQIVVAMGGGSTAALSAFDFLIRHSAPAETESQAQAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgccgacctcaagccccagctggccgcctacctcgaaaaactgcagcagccg
atcgaactggttgcctcgctggacgcttcggatgccgcgcgcgaactcgacgtgctgctg
gacgagatcgccgcgctgtcgccgaagatttcccgcgtgaccggtgacgatgcgcgcaag
ccctcgttcctgatccgccgcgcgggcagcgacgtgcaggtgggtttcgccggcattccg
ctgggccacgaattcacctcgctggtgctggcgctgctgcaggtcggcgggcatccggtg
aagatcgacgaagcgctggccgagcaggtacgcgcattggatggcgattacgccttcgag
acctatatgtcgctgcattgccagagctgcccggacacggtgcaggcgctgaacgcgatg
agcgtgctcaatccgcgcatcaagcatgtcgccatcgacggctcgttgttccaggccgaa
gtggaagcgcgcgaaatcctgtcggtaccgaccatctacctcaacggcgccgagttcgat
gccggtcgcatgagcatcgaacagatcctcgccaagctggacaccggcgctgtcgcgcgc
accgcgcaggtactgaacgaagccgcgccgttcgacgtgctgatcgtcggcggcggcccg
gccggcgccgcagcggcgatctatgccgcgcgcaagggcatccgcaccggcatcgtcacc
gagcgcttcggtgggcaggtgctggacaccatggccatcgagaatttcccctcggtggaa
tacaccgaaggcccgaagctggccgcatcgctggaagcgcatgtgcgcagctatggcgtg
gaaatcatgaccgcgcagcgcgccaaggcgttgcagccggcggcgcagacgggcgggttg
atcggcatcgaactggaaagcggtgccaccctgcatgcgaagacggtgatcctgagcccc
ggcgcacgctggcggcagaccggcgtgcccggcgagtccgagcatcgcaacaagggcgtg
acctattgcccgcactgcgatggcccactgttcaagggcaagcgggtggcggtgatcggt
ggcggcaattccggcgtggaggcggcaatcgacttggccggcatcgtggatcacgtgacc
gtgctcgagttcgacggccagctgcgcgcggacgacgtgctgcagcgcaaactgcacagc
ctgcccaacaccaccgtacacgtgaacgcgcaaaccaccgaaatggtgggcgatggcggc
cgtttgaccggcctgcgcttcaccgaccgcaccaatggccagccgagtgatctggaactg
gccggcgtgttcgtgcagatcggcctgctgccgaataccgattggctgaagggcacggtg
gcgctgagcccgcgcggcgagatcgcgatcgacgacaagggccataccgatgtgcccggc
gtgttcgccgccggcgatgccaccaccgagccgttcaagcagattgtggtggcgatgggt
ggcggttcgaccgccgcgctgtccgccttcgacttcctgatccgccactcggcgccggca
gaaaccgaaagccaggcgcaggcggcctga

DBGET integrated database retrieval system