KEGG   Thermosipho sp. 1070: Y592_03290Help
Entry
Y592_03290        CDS       T04909                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
ther  Thermosipho sp. 1070
Pathway
ther00220  Arginine biosynthesis
ther00250  Alanine, aspartate and glutamate metabolism
ther00270  Cysteine and methionine metabolism
ther00330  Arginine and proline metabolism
ther00350  Tyrosine metabolism
ther00360  Phenylalanine metabolism
ther00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ther00401  Novobiocin biosynthesis
ther01100  Metabolic pathways
ther01110  Biosynthesis of secondary metabolites
ther01130  Biosynthesis of antibiotics
ther01210  2-Oxocarboxylic acid metabolism
ther01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ther00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Y592_03290
   00270 Cysteine and methionine metabolism
    Y592_03290
   00220 Arginine biosynthesis
    Y592_03290
   00330 Arginine and proline metabolism
    Y592_03290
   00350 Tyrosine metabolism
    Y592_03290
   00360 Phenylalanine metabolism
    Y592_03290
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Y592_03290
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Y592_03290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ther01007]
    Y592_03290
Enzymes [BR:ther01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Y592_03290
Amino acid related enzymes [BR:ther01007]
 Aminotransferase (transaminase)
  Class I
   Y592_03290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP Alliinase_C DegT_DnrJ_EryC1 Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ANQ53525
LinkDB All DBs
Position
661411..662532
Genome map
AA seq 373 aa AA seqDB search
MNIIDEIPSSKTLEINATAKKLISQGKDVINLTTGEPDFPTPDIIKKKAIEALEKDFTKY
TDSKGIPELRKTISILLERKNISFSKDEIIVTNGGKQALFNSLLSIAEKGDEIILISPFW
VSYPPMVILAGATIKILETSFENNFHPNIDKLKSLISKKTKAIVVNSPNNPTGTVYPENI
IKEIADIANKNNIFVITDEVYDVLVYDGKYASLTKFVNPENLIYINAFSKSYAMTGWRIG
YVATKNKSILKRIAKIQAHSTSGINSIAQYAALGALNADNSYMIKEFKKRKDFVVKKAKE
LGLRFVEPKGAFYLFFEVNIDDELFCKKLLEEKLVALVPGSAFNAKGFVRMSFANSLENI
KKAFERLEEFLRG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcatcgatgaaattccatcatcaaagactttagaaataaacgcaactgccaag
aagctaataagtcaaggcaaagacgtaattaacctcacaacgggtgaacctgattttccc
acaccagatataataaagaaaaaagccattgaagcacttgaaaaggattttacaaaatac
acggatagcaagggaatccctgaacttagaaaaaccatctcaatacttttggaaagaaaa
aatatttcattttcaaaagacgaaataatcgtaacaaatggaggaaaacaagccttattt
aattccctgttatccattgccgaaaaaggtgatgaaataatactaatatctccattttgg
gtcagctacccacctatggttattctcgccggggccactataaaaattctagaaacaagt
tttgaaaacaatttccaccccaatatagataaactaaaatctttaatctctaaaaaaaca
aaagccatagttgtaaactctccaaataaccccacgggaacagtctatccagaaaatata
ataaaagaaattgcagatattgcaaataaaaacaatatttttgtcataacagatgaagtt
tacgacgtactcgtatacgacggtaaatacgcatctttgacaaaatttgtaaatcccgaa
aatctcatatatatcaatgccttttccaaatcatatgcaatgactggttggagaattgga
tacgttgcaacaaaaaacaaatccatcctaaaaaggattgcaaaaatacaagcccacagc
acttcaggtataaattctattgcacaatatgctgcacttggagcactaaatgcggacaac
tcgtatatgataaaggaatttaagaaaagaaaagactttgtggtaaaaaaagccaaagaa
ctgggacttagatttgtagagccaaagggagcattttatcttttctttgaagttaatata
gatgatgaattattctgcaaaaaacttttagaagaaaagctagtagcattggtaccaggc
agtgcttttaatgcaaaaggatttgttagaatgtcttttgcaaattcccttgaaaatatt
aaaaaagcatttgaaagacttgaagaattcttaagggggtaa

DBGET integrated database retrieval system