KEGG   Thermosipho sp. 1070: Y592_04800Help
Entry
Y592_04800        CDS       T04909                                 

Definition
(GenBank) ABC transporter
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
ther  Thermosipho sp. 1070
Brite
KEGG Orthology (KO) [BR:ther00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ther02000]
    Y592_04800
Transporters [BR:ther02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    Y592_04800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA_15 AAA_22 AAA SMC_N SRP54 MMR_HSR1 AAA_7 SbcCD_C RsgA_GTPase AAA_30 FtsK_SpoIIIE AAA_16 DUF5442 Zeta_toxin CbiA
Motif
Other DBs
NCBI-ProteinID: ANQ53749
LinkDB All DBs
Position
949562..950305
Genome map
AA seq 247 aa AA seqDB search
MIKAEKLTRKFGNFVAVNGIDLYIEKGKIFGFLGPNGAGKTTTIRMLTGSLRPTSGKVEI
FGLDMKTHELEIKRRIGVVPDEPRIYDHLRGYEYLEFIMDIYRQNTKEVKKRIEELSEAF
GVDYLDKQISDMSHGMKQKLMVISVLMRKPEVIFLDEPTVGLDAKSAKILKELLRKYANQ
GVTIFLTTHILEIAEKMCDEIAIINKGEIIAQGDIETLKQGENKSLEDLFLELTAQEEDI
KNIVDSL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagcggaaaagttaactagaaaatttgggaattttgttgcggtaaatggtatt
gatttgtatattgaaaagggaaaaatttttggatttttgggtccaaatggtgcgggaaaa
acaacaacaattcgcatgttaactgggtctttaagacctacaagtggtaaagtggaaatt
tttgggcttgatatgaaaacacatgaattagagataaaaagaagaataggagttgtacca
gatgaacctagaatttacgatcatttgaggggatatgaatatctagagtttataatggac
atttacaggcaaaatactaaggaagttaaaaagaggatagaagaactatccgaggcattt
ggggttgattatcttgacaagcaaatttccgatatgtcgcatggtatgaaacaaaaattg
atggtaataagcgttttgatgagaaagccagaagttatatttttagatgaaccaactgta
ggattagatgcaaagagtgcaaagattttaaaagagcttttgagaaaatatgcaaatcaa
ggagttacaatttttctaacaactcatatattagagatagcagagaagatgtgtgatgaa
atagctattataaataaaggagagataatagcacagggggatattgaaactttaaaacaa
ggagaaaacaaatcgcttgaagacctctttttggagttaactgcacaagaagaagatata
aaaaatattgtggattcactttaa

DBGET integrated database retrieval system