KEGG   Thermoleptolyngbya sp. PKUAC-SCTA183: HPC62_22255
Entry
HPC62_22255       CDS       T06607                                 

Definition
(GenBank) 2-oxo acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
theu  Thermoleptolyngbya sp. PKUAC-SCTA183
Pathway
theu00010  Glycolysis / Gluconeogenesis
theu00020  Citrate cycle (TCA cycle)
theu00620  Pyruvate metabolism
theu01100  Metabolic pathways
theu01110  Biosynthesis of secondary metabolites
theu01120  Microbial metabolism in diverse environments
theu01200  Carbon metabolism
Module
theu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:theu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPC62_22255
   00020 Citrate cycle (TCA cycle)
    HPC62_22255
   00620 Pyruvate metabolism
    HPC62_22255
Enzymes [BR:theu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HPC62_22255
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Other DBs
NCBI-ProteinID: QKD84546
UniProt: A0A6M8BJ70
LinkDB
Position
5349422..5350738
AA seq 438 aa
MIHEVFMPALSSTMTEGKIVSWVKAPGDKIEKGETVVVVESDKADMDVESFYEGYLATII
VDAGSTAPVGEAIALIAETEAEIETAKQKAASASAPAPAAPTPAPATTEPEPVAATVEEA
IASSNGSSGRLVVSPRARKLAKELKVDLATLKGSGPHGRIVAEDVEAAVGRVSEPATPAV
TPAPAAVAAPVAASAPAPAAATPKPTPAPAAPVTPGQVVPLTTLQNAVVRNMVASLEVPT
FHVGYTITTDNLDKLYKQIKSKGVTMTALLAKAIAVTLKKHPLLYAAYTDQGIQYNSGIN
VAVAVAMDDGGLITPVLQAADQMDIYTLSRTWKDLVDRARSKQLQPAEYSTGTFTLSNLG
MFGVDRFDAILPPGQGAILAIGTSRPQVVATADGLFGVRTQMQVNLTADHRIIYGAHAAA
FLQDLAKLIETDAQSLTL
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgatccacgaagttttcatgcctgcgctcagttctacgatgaccgagggaaaaatcgtt
tcctgggtaaaagcaccgggcgacaaaatcgaaaagggcgaaaccgtggtggtggtggag
tccgataaggcagacatggacgtggagtcgttctatgaaggctatttggcaacgattatt
gtggacgcaggcagcacggctccggtgggcgaggcgatcgccctgattgccgaaactgag
gcagagatcgagaccgcaaagcagaaggctgccagcgcctcggctcccgctccggctgcc
ccgactcctgcgcctgctactaccgaaccggaacccgtcgctgcgaccgtggaagaggcg
atcgccagcagcaacggcagttctgggcggctcgtcgtgtcgccccgcgctcgcaagctg
gccaaagaactcaaggttgacctagccacgctcaaaggcagtggtccccacggacgcatc
gtcgccgaagatgtggaagccgctgttggcagagtgtctgagcctgcaactccggctgtg
actccggctccggctgcggttgctgctccggtggctgcgtctgctccggctccggctgcg
gcaactcctaaacccaccccggctccggcggcccccgtcacacccggccaggtcgtgccc
ctgaccacgctgcaaaatgccgttgtgcggaacatggtcgccagcctagaggtgcccacc
ttccacgtcggctataccatcaccaccgacaacctggacaaactctacaagcagatcaaa
tccaagggcgtaacgatgacagcactgctggctaaggcaattgccgtgaccctgaagaag
catccgctactctacgcggcctacaccgaccaaggcattcagtacaacagcggcatcaat
gtggcggtggcggtggcgatggacgatggcggactgattacgcccgttctgcaagccgct
gaccaaatggatatctacaccctgtcgcgcacctggaaggacttggtcgatcgcgcccgc
tcgaagcagctccagcctgcagaatacagcacaggaacgtttacgctctccaacctggga
atgttcggcgttgatcgctttgatgctatcttgccgcccggccagggcgcgattctggcg
atcggcacatcccgcccgcaggtggtggcgaccgcagacggactattcggcgtgcggacg
caaatgcaggtcaacctgactgccgatcaccggattatctacggtgcccacgccgcagcg
ttcctccaagacctggccaagctgatcgaaaccgacgcgcaatcgctgacgctgtaa

DBGET integrated database retrieval system