KEGG   Thermofilum uzonense: MA03_03620Help
Entry
MA03_03620        CDS       T03924                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
thf  Thermofilum uzonense
Pathway
thf00630  Glyoxylate and dicarboxylate metabolism
thf01100  Metabolic pathways
thf01120  Microbial metabolism in diverse environments
thf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MA03_03620
Enzymes [BR:thf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MA03_03620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N DUF697
Motif
Other DBs
NCBI-ProteinID: AKG38552
UniProt: A0A0F7FH63
LinkDB All DBs
Position
complement(713167..714498)
Genome map
AA seq 443 aa AA seqDB search
MPEEFEPYPEFVKWGYTPDPKNEVIVTFRLTPSEGFTVDDAAGGVAAESSVGTWTTLYQW
YDQSRLDRLKGKAYEYKDLGDGSYLVRIAYPVELFEEANMPAFLASVAGNIFGMRRVKGL
RVEDIYLPPVFLKGFKGPSKGINGIREVMRISKRPIIGTVPKPKVGYSPDEVEKLAYDLL
IGGMDYVKDDENIASPSFCRFEERAKAIMKSIDRAEKETGERKAWFANITADVREMERRL
KLVADYGNPYIMVDVVITGWSALTYIRDLAEEYGLAIHGHRAMHAAFTRNPYHGISMFTL
AKLYRIIGIDQLHVGTPEVGKLEAKTVDVVRNARVLRDPVYTPDSDDVFHLEQPLNEFKP
SFPVSSGGLHPGTLPEVIRSMGLDLVIQVGGGVVGHPDGPRAGAAAARQAVEAAIEGTDL
AEYAKTHRELARAIEKWGFVKPA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagaatttgagccttatcctgaattcgtgaagtgggggtacactccagaccca
aagaacgaggttatagttactttccgtctaaccccgagcgagggctttaccgttgacgac
gcagctggcggtgtggctgcagagagcagcgtcgggacctggacgactctctaccagtgg
tacgaccagtctagactagaccgtttgaagggtaaggcctatgagtacaaggatctaggg
gatggctcataccttgtgaggatagcttaccctgtcgagctttttgaagaggcgaacatg
cccgcctttctagcgtctgttgccgggaatattttcggcatgaggcgagtgaagggccta
agagttgaggacatatatctcccgcccgttttcctaaaggggttcaaggggccctcaaag
gggataaatgggataagggaagtcatgaggattagcaagaggccgattatcggaaccgtt
cctaaacccaaggtcgggtattcgcccgacgaggtggagaagcttgcatacgatctgctt
atagggggtatggactacgtcaaggatgacgagaacatcgctagccccagcttctgtagg
tttgaggagagggccaaggctatcatgaagtccattgacagggctgaaaaggagacgggt
gaaaggaaggcttggtttgcaaacatcacggctgacgtcagagagatggagcggagactg
aagctggtagcagactacgggaacccgtatataatggtggacgtggttataacggggtgg
tcggcgctcacatatatccgggacctggcagaggagtatggcctcgctatccacggccac
agggcgatgcatgcagctttcacgaggaacccctaccacggcatctccatgttcaccctc
gccaagctctacaggattataggtatagaccagctacacgtcggaacccccgaggtcggg
aagctggaggcgaagacggtggacgttgttaggaatgcaagggttctaagagatcccgtt
tacacgcccgacagtgacgacgtcttccaccttgagcagcccctaaacgagttcaagccc
tccttccccgtatcgagtggaggactacaccccggcacgctcccagaagtcataaggagt
atgggtttggatctagtcatacaggttgggggaggcgtcgtcgggcacccagatggaccg
agagctggcgctgcagctgctagacaagccgtcgaggcagcgattgagggcacagacctc
gcagagtacgcgaagacccatagagagctcgcgcgagctatcgagaagtgggggttcgtg
aagccggcctag

DBGET integrated database retrieval system