KEGG   Thermofilum uzonense: MA03_05800Help
Entry
MA03_05800        CDS       T03924                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
thf  Thermofilum uzonense
Pathway
thf03030  DNA replication
thf03410  Base excision repair
thf03420  Nucleotide excision repair
thf03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:thf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MA03_05800
   03410 Base excision repair
    MA03_05800
   03420 Nucleotide excision repair
    MA03_05800
   03430 Mismatch repair
    MA03_05800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:thf03032]
    MA03_05800
   03400 DNA repair and recombination proteins [BR:thf03400]
    MA03_05800
Enzymes [BR:thf01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MA03_05800
    6.5.1.6  DNA ligase (ATP or NAD+)
     MA03_05800
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MA03_05800
DNA replication proteins [BR:thf03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    MA03_05800
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     MA03_05800
DNA repair and recombination proteins [BR:thf03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     MA03_05800
   NER (nucleotide excision repair)
    Other NER factors
     MA03_05800
   MMR (mismatch exicision repair)
    Other MMR factors
     MA03_05800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AKG38868
UniProt: A0A0F7FHV4
LinkDB All DBs
Position
complement(1128974..1130779)
Genome map
AA seq 601 aa AA seqDB search
MEQNDLPYGVLVDFYEKIEATTSRLAMTDYLVALFKKTPTNVLDKVIYLTQGQLRPDYEG
VELGVAEKLTLRAISKASGVSLKSVEELYKKTGDPGLVAEELLSKPRQSAGLLGYIGEET
GKRELMVSHVYNSLMKIALASGEGSQDTKINTLASLLSDASPKEAKYIVRTVTGKLRLGI
ADMTILDALAVAFTGTKSARDVLERAYTRRPDLGFIARTLAEKGLEAVRSIRIEVGVPIL
PMLAERLGDPGEILEKLGGSCLAEFKYDGERVQAHRKGDKVWLFSRRLENITSHYPDVVN
FMLTLKADEFIVEGEIVAYNPDTGDMLPFQELMHRRRKYDVKKAMEEYPVRVYLFDIVYL
NGEELIEKPLPERRKILESITPPRDENILLSQAKLVDNVKDLMLFFEEAISEGCEGVMCK
STGNQSIYQMGARGWLWIKFKRDYRMEMTDTVDLVVVGAFHGRGKRAGTYGALLMAAYDP
NSDTFKTVCKVGSGFTDEDLANLPKLLEPYKIPHRHPRVVSKLEADVWFVPAVVLEIIGA
EITLSPLHTCALGKIEPDSGLAVRFPRFTGRYRFDKKPEQATTESELIEMYKSQRKTVVQ
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggagcagaatgaccttccatatggtgtcctagtcgatttctacgagaaaatcgaggcg
acaacaagcaggctagccatgacagattatctcgtggccttgttcaaaaagactcccacc
aatgtcttagacaaggttatatatctaacacagggacagctacgaccggactacgaagga
gtagagctcggcgttgccgaaaagcttactttaagggcaatctctaaggctagcggtgtc
tctctcaaatctgtcgaggaactctacaagaaaaccggggatcctggcttagtagcggaa
gaactcctctctaagcccagacagtccgccggtctcttaggctacataggagaagaaact
ggtaaacgtgagttgatggtctcccatgtttataactcgctgatgaagatagcactggct
tcaggggagggaagccaggatacaaaaatcaacacgcttgcaagcctcctatcagatgcc
tcaccgaaggaggcgaagtatatcgttaggacagtcacgggtaagcttcgccttggtata
gctgacatgacaattctggacgccctggctgtagccttcacaggcacaaagtcggcacgc
gacgttctcgagagggcatacacgcggaggcccgatctaggctttattgcgcgtacactt
gcggagaagggcttagaggctgtgagatcgataaggatcgaggttggagtacctattctc
ccaatgttggctgagagactgggtgatcccggcgagattctagaaaagctgggaggatca
tgtctagccgagttcaagtatgacggtgaacgtgttcaagcccacaggaaaggtgataag
gtctggctttttagcaggcgtcttgaaaacataacaagccactacccagacgtcgtgaac
ttcatgttaacactaaaggcagatgagtttatagtagagggagaaatagtagcttataac
ccagacacgggagacatgctgcccttccaggagctcatgcacaggcgccgcaagtatgat
gttaagaaagcgatggaggagtacccggttagagtatatctctttgacatagtctacctt
aatggagaggagctaatcgaaaagcccctcccggaaagaagaaaaatacttgaatctata
acgccaccgcgggacgagaacatactcctctcccaggctaaactcgttgataatgtaaaa
gacctcatgctcttcttcgaggaggccataagcgaaggatgtgaaggagtaatgtgtaaa
tccactgggaatcagagcatataccagatgggagctagaggctggttgtggataaagttc
aagcgggactacaggatggagatgacagacacagtggaccttgtcgtggttggagctttc
catggtagaggaaaacgtgccggaacctatggagccctgctgatggcagcctatgaccct
aacagcgacacgtttaaaacggtttgcaaagttggctctggtttcaccgacgaggactta
gcaaacctgccaaagctcctagagccctacaaaatcccgcaccgtcacccacgtgtggtt
tcaaaactagaggctgatgtgtggtttgtcccagccgttgtactcgagattatcggagcg
gaaattactctgagtcctcttcacacctgcgcgctcggaaaaatagagccagattcgggt
ctagcagtgaggttccccaggttcacgggtcgttataggtttgacaaaaaacccgagcaa
gctactactgagtctgagctgatagaaatgtataagtcccagaggaaaacagtggttcag
gcctga

DBGET integrated database retrieval system