KEGG   Thermofilum uzonense: MA03_07670Help
Entry
MA03_07670        CDS       T03924                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
thf  Thermofilum uzonense
Pathway
thf00010  Glycolysis / Gluconeogenesis
thf00020  Citrate cycle (TCA cycle)
thf00620  Pyruvate metabolism
thf00633  Nitrotoluene degradation
thf00640  Propanoate metabolism
thf00650  Butanoate metabolism
thf00680  Methane metabolism
thf00720  Carbon fixation pathways in prokaryotes
thf01100  Metabolic pathways
thf01110  Biosynthesis of secondary metabolites
thf01120  Microbial metabolism in diverse environments
thf01130  Biosynthesis of antibiotics
thf01200  Carbon metabolism
Module
thf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MA03_07670 (porA)
   00020 Citrate cycle (TCA cycle)
    MA03_07670 (porA)
   00620 Pyruvate metabolism
    MA03_07670 (porA)
   00640 Propanoate metabolism
    MA03_07670 (porA)
   00650 Butanoate metabolism
    MA03_07670 (porA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MA03_07670 (porA)
   00680 Methane metabolism
    MA03_07670 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MA03_07670 (porA)
Enzymes [BR:thf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MA03_07670 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AKG39139
UniProt: A0A0F7FIB5
LinkDB All DBs
Position
1455305..1456492
Genome map
AA seq 395 aa AA seqDB search
MKGKLVGMNGDRAVAFAAKQADVDVISAYPITPQTIIVETLAEYVNNGELNAAFIPVESE
HSALSAAVGASLAGARVFTATSSQGLALMWEILWIAAGLRTTIVMAMGNRALSPNINIHC
SHDDAYAARDTGWLQFFAENVQEAYDLTLMAFRISEDHRVLFPSIVNLDGFILTHATEGL
YVLDDEDVKAFLPKKKPVNPIDPSKPMTYGPLDLFDWYMEHRRLQYASFMSTPPVIKEVF
EEYGKLSGRRYTPVKTFNVEGAEVVLMVLGSSAGTVRYVSRKLAEKGKKVGVVSLTQYRP
FPVRELIEALSGASVVAVMDRSVSFGSPGAQLFMDTSTALLKAKRRPLLFNVVYGLGGRD
LTPGDVEKIVMKAEEVLRRGESPEEPVWVGVRGEE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtaaacttgtgggaatgaacggtgacagggctgtagccttcgcggctaagcag
gcagatgtcgacgttatctcggcgtacccgataaccccccagacgataatcgtcgagacg
ctcgccgagtacgtgaacaacggcgagcttaacgcggccttcatcccggtggagagcgag
cactccgccctctctgcagccgtgggcgcctcgctcgctggcgctagggttttcacggct
acgagcagccagggattagcgcttatgtgggagatactatggatagccgcaggcctgcgg
acaacaatagtcatggccatgggtaacagggccctctctccaaacatcaacattcactgc
tctcacgacgacgcttacgcggcgcgagacacgggatggctgcagttcttcgccgagaac
gtgcaggaggcctatgacttgaccttgatggccttcaggatatccgaggatcaccgcgtg
ctgttcccgagcatagttaacctggacggcttcatactgacgcatgctactgaggggctg
tatgtgttggatgatgaggacgttaaggcattcctgcccaagaagaagcctgtgaacccg
atcgacccgagtaagccgatgacctatggtcccctagaccttttcgactggtatatggag
cacaggcgcttgcaatacgcctccttcatgtctacgcctcccgttataaaggaggtcttc
gaggagtacgggaagctctcaggaagaagatacacgccggtgaagaccttcaacgttgag
ggagctgaggtcgtgctgatggttctaggcagctcggcgggaactgttcgctatgtatcc
aggaagcttgccgagaagggtaaaaaggtgggtgttgtaagccttacccagtacaggccc
ttcccggttcgtgagcttatcgaagcgttgagcggcgcgtcggtagtggcggtcatggat
cgcagcgtcagctttgggagccccggcgcccagctcttcatggacacctcgacggccctc
ctaaaggcaaagaggagacccttactattcaacgtcgtctacgggctcggcgggagggat
ctaacaccgggagacgtcgagaagatcgttatgaaggctgaggaggttttaaggaggggt
gagtcccccgaggaacctgtatgggtaggagttagaggtgaggagtaa

DBGET integrated database retrieval system