KEGG   Thermogladius calderae: TCELL_0363Help
Entry
TCELL_0363        CDS       T02127                                 

Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
thg  Thermogladius calderae
Pathway
thg00630  Glyoxylate and dicarboxylate metabolism
thg01100  Metabolic pathways
thg01120  Microbial metabolism in diverse environments
thg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TCELL_0363
Enzymes [BR:thg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TCELL_0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AFK50788
UniProt: I3TDF0
LinkDB All DBs
Position
337416..338750
Genome map
AA seq 444 aa AA seqDB search
MTKEGFEPYPEYVDKKYQPDPDTHVIVTFRVKPASGFTVEDAAGGVAAESSTGTWTTLFS
WYDVSRVKKLSGRAYYFKDLKDGSYIVRVAYPVELFEEGNMPAFLASVAGNIFGMRRVEG
LRVEDIYLPKQFLQYFKGPFKGVKGVREIFKVHDRPIVGTVPKPKVGYTPEEVEKLALEL
LMGGMDYIKDDENLASPSFCRFEARAKSIMKIIDKVEKETGERKAWFANITADVREMEKR
LKLVADYGNPYIMVDVVVTGWSALTYIRDLAEEYKLAIHAHRAMHAAITRNPYHGISMFA
LAKLYRFIGMDQLHIGTAGAGKLEGAKLDVVRIAKMLRAEDYQPDPDDDFHLPQKMYHIK
PMMPVSSGGLHPGNLPIVIEALGTDLVLQIGGGTIGHPDGPRAGATAVRQALDAIIKGIP
LEEYAKDHKELARALEKWGFAKPI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
ttgactaaggagggcttcgaaccataccccgagtatgtcgacaaaaaataccagccagac
cctgatactcacgtgatagtcactttcagagtcaagccggcctccgggtttactgtagag
gacgcggcaggcggggtagcggcggagagtagcactggcacttggaccacgctgttcagt
tggtacgatgtctcgagggttaagaagttaagtggtagagcctactacttcaaggacttg
aaggacggttcctacattgtcagagtagcctaccctgtcgagctgttcgaggaagggaac
atgccggcattcttggcaagtgtcgctggcaacatcttcggtatgaggagagttgagggt
ctgagagtggaggatatctacctgccgaagcagttcctccagtacttcaaaggccccttc
aagggcgttaaaggggtaagagagatattcaaagtccacgacagacccattgtagggact
gtgcctaagcctaaagtgggctatactcccgaggaggtcgagaagctagcgctcgagctt
ctaatgggaggaatggactacataaaagacgacgagaacctggccagccctagcttctgc
cggttcgaggctagggcaaagtcgatcatgaagatcatcgacaaagtcgagaaagagaca
ggtgagaggaaagcttggttcgccaatataactgccgacgtgagagagatggagaagagg
cttaagctggtggcagactacggtaacccctatataatggtcgacgttgtcgtcacgggc
tggtcggctctaacctacattagagacctcgcggaggagtacaagctagcgattcacgct
cacagagcgatgcacgctgctattacgagaaacccctaccacggtatttcaatgttcgca
ctcgctaagctgtacaggttcataggtatggaccaactacacataggtacggcgggggcg
ggcaagctcgagggcgccaagttagacgtggtcaggatagccaagatgctcagggcggag
gactaccagcccgatcccgacgacgacttccacctacctcagaagatgtaccacatcaag
ccaatgatgcccgtgtcttctggcggcctacatcccggtaatctaccaatagtgatcgaa
gcccttggtacagacctcgtcttgcagataggtggaggtacaatagggcacccagacggc
cccagggcgggagctactgcagttaggcaggctcttgatgcgataataaaggggataccc
ctagaagagtacgcgaaagaccacaaagaactcgcgagagccttggagaagtggggcttc
gccaagcctatataa

DBGET integrated database retrieval system