KEGG   Thermococcus sp. 5-4: CDI07_00990Help
Entry
CDI07_00990       CDS       T05088                                 

Definition
(GenBank) RNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
thh  Thermococcus sp. 5-4
Brite
Enzymes [BR:thh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CDI07_00990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ASA76930
UniProt: A0A1Z2TKF8
LinkDB All DBs
Position
173279..174421
Genome map
AA seq 380 aa AA seqDB search
MVSSSFRAMLLKLGVPEDRLAVLEGKGGVVEGEFEGIRYVRFRDSAKGFRRGTVVFENGD
VVLGFPHIKRVVQLERGIKRVFKNKPFHVEEKVDGYNVRVVKVRDRVLALTRGGFVCPFT
TERILDFVNEEFFRDYPNLVLAGEMAGPESPYIVEGPPYVKEDIQFFLFDIQENGTGRSL
PVEERLKLAEEYGIRHVETFGLYDRSKIEELHELIERLSRERREGIVMKTPDMKRIAKYV
TPYANINDIRIGSHIFFDLPHGYFMGRIKRLAFYLAEKHVKGEEFDEYAKALSKALLRPF
VESIHEVANGGEVEEVFTVRVKNISTAHRMVTHFERLGVKIHIEDIEDLRNGYWRITFKR
VYPDATREMRELWNGLAFVD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggtaagctcaagctttagggcaatgcttctcaagctcggcgttcctgaggacaggctg
gccgttcttgagggtaagggtggagtggtggagggcgaattcgaaggcatcagatacgtt
cgctttcgcgattctgccaagggcttccggcgtggaaccgttgtctttgagaacggtgac
gttgtcctagggtttccccacataaagcgcgtcgtccagctggagagggggataaagagg
gtcttcaagaacaaacccttccacgtcgaggagaaggtggacggctacaatgtccgtgtc
gtcaaggttcgagacagggttctcgccctcaccaggggaggtttcgtctgccccttcacg
actgagaggatactcgacttcgtgaacgaggagttcttcagggattaccccaacctagtc
ctggccggcgagatggccgggcccgaaagcccgtacatcgtggaggggccgccctacgtg
aaggaggacatccagttcttcctctttgacatccaggagaatggaacggggaggagcctt
ccggtggaggagaggctcaagcttgccgaggagtacggcattcgtcacgttgaaactttc
ggcctctacgaccgttcaaaaattgaagagctacatgagctgatcgaaaggctcagccgg
gagaggagagagggcatcgtcatgaaaacgcctgacatgaagagaatcgcgaaatacgta
acgccatacgccaacattaacgacatccggataggttcccacatattcttcgacctgccg
cacggctacttcatggggaggattaaacgcctcgcgttctacctggccgaaaagcacgtt
aagggcgaggaattcgacgaatatgcgaaagccctcagcaaggccctcctccggccgttc
gtcgagagcatccacgaagtcgccaacggcggcgaggttgaggaggtcttcacggtgagg
gtgaagaacataagcaccgcccacaggatggtgacccacttcgagagactcggcgtgaaa
atccacatcgaggacatagaggatctcaggaacggctactggcggataaccttcaagagg
gtctatccagacgccacacgcgagatgagggagttgtggaacgggctggcgtttgtggat
taa

DBGET integrated database retrieval system