KEGG   Thermococcus sp. 5-4: CDI07_02635Help
Entry
CDI07_02635       CDS       T05088                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
thh  Thermococcus sp. 5-4
Pathway
thh00260  Glycine, serine and threonine metabolism
thh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDI07_02635 (tdh)
Enzymes [BR:thh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     CDI07_02635 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ASA77231
UniProt: A0A1Z2TL98
LinkDB All DBs
Position
complement(468295..469347)
Genome map
AA seq 350 aa AA seqDB search
MAEKMPAIVKTKPAYGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIK
PPQIMGHEVAGEVIEVGPGVDTLEVGDYISAETHIVCGKCYACRHNRYHVCQNTKIFGVD
MDGVFAEYAIVPAQNAWKNPKGMKPEYATLQEPLGNAVDTVLAGPIAGRSTLITGAGPLG
LLGIAVAKASGAYPVIVSEPSEFRRELAKKVGADYVVNPFEEDPVKFVMDVTDGAGVEVF
LEFSGAPKALEQGLKATTPGGRVSLLGLFPRDVTLDFNNLIIFKALEVHGITGRHLWETW
YTVSSLIQSGKLNLDPVITHKYKGFDDFEEAFELMRAGKTGKVVFFPHKG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaagatgcccgcgattgtaaaaaccaagcccgcttacggtgctgagctcgtc
gaggtcgacgttccaaagcccgggccgggcgaggttctcatcaaggttctcgccaccagc
atatgcggaaccgacctccacatctacgagtggaacgagtgggcccagagcaggatcaag
ccgccccagattatgggccacgaggtggccggtgaggtcatcgaggtcggtcccggcgtt
gacaccctcgaggtcggcgactacataagtgcggaaacgcatatcgtctgcggcaagtgc
tatgcgtgcaggcacaaccgctaccacgtctgccagaacacgaagatcttcggcgtcgat
atggacggtgtcttcgcggaatacgcgatagttccggcccagaacgcctggaagaacccg
aagggcatgaagcccgagtacgccaccctccaggagccgctcggcaacgctgttgacacc
gttttagcggggccgatagccggaaggagcactctcataaccggcgccggaccccttggg
ctgctcggcatagcggttgccaaggcttcgggagcttacccggtcatcgtgagcgaaccg
agcgagttcaggcgtgagctggccaagaaagtcggtgcggactacgtggtcaatcccttc
gaggaggacccggttaagttcgtgatggacgtgaccgacggggcaggagttgaggtgttc
ctcgagttcagcggtgcccccaaggctctcgaacagggtctcaaggccaccacccccggt
ggaagggtttccctgctcggtctgttcccccgcgacgtcacgctggacttcaacaacctg
ataatcttcaaggccctcgaggttcacggcataaccggaaggcacctctgggagacctgg
tacaccgtgtccagcctgatccagagcggcaagctcaacctcgaccctgttatcacccac
aaatacaagggcttcgatgatttcgaggaagccttcgagcttatgcgcgccggcaagacc
ggaaaggtggtcttcttcccgcacaagggttga

DBGET integrated database retrieval system