KEGG   Thermococcus sp. 5-4: CDI07_06755Help
Entry
CDI07_06755       CDS       T05088                                 

Gene name
rbcL
Definition
(GenBank) type III ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
thh  Thermococcus sp. 5-4
Pathway
thh00630  Glyoxylate and dicarboxylate metabolism
thh01100  Metabolic pathways
thh01120  Microbial metabolism in diverse environments
thh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CDI07_06755 (rbcL)
Enzymes [BR:thh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CDI07_06755 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N DUF697
Motif
Other DBs
NCBI-ProteinID: ASA78008
UniProt: A0A1Z2TNI3
LinkDB All DBs
Position
complement(1220290..1221621)
Genome map
AA seq 443 aa AA seqDB search
MVEKFEIYDIYVDKDYEPNPKRDLVAVFRITPAEGFSIEDAAGAVAAESSTGTWTSLYQW
YEKERWDDMSAKAYHFHDMGDGSWIVRIAYPIHLFEEWNMPGMLASVAGNVFGMKRVKGL
RLEDIYLPEKFLREFEGPYFGKDGVKRIFDVKDRPIVGTVPKPKVGYSPEELEKLAYDLL
SGGMDYIKDDENLTSPWYNRFETRAEVLMNVIDRVEDETGEAKSWFANITADVREMERRL
EILADYGNPHAMVDVVVTGWGALEYIRDIAADYGIAVHGHRAMHATFTRDPYHGISMFVL
AKLLRVIGIDQLHVGTAGAGKLEGSKWDVIQIARVFREEHYVPDETDVFHMEQKFYHIRP
AMPVSSGGLHPGNIEPVIDALGKDIVLQIGGGTLGHPDGPKAGAMAVRQALDAIMQGIPL
DEYAKSHRELARALEKWGHVTPV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggtagagaagtttgagatatacgacatctacgtggacaaggactacgaacccaaccca
aagagggacctggtggctgttttcaggataacccccgcggagggattcagcatagaggat
gccgctggagccgtcgcggcggagagctcgactggaacctggacgagcctctaccagtgg
tacgagaaggaaagatgggatgacatgtcggctaaggcgtaccacttccatgacatgggg
gacggcagctggatcgtcaggatagcctatccgattcatctgttcgaggagtggaacatg
cccggcatgctcgccagcgtcgccggcaacgtcttcggaatgaagcgcgttaagggactc
cgcctcgaggacatctacctcccggagaagttcctccgcgagtttgaggggccgtacttc
ggaaaggacggcgtcaagaggatttttgacgtcaaggacaggccgatagttggaacggtt
cccaagccgaaggtcggctattcgccggaggagcttgaaaagctcgcctacgacctgctc
agcggcggaatggactacataaaggacgacgagaacctgaccagcccctggtacaaccgc
tttgagactagggcggaggttctgatgaacgtcatagacagggtcgaggacgagaccggc
gaggccaagagctggttcgccaacataaccgccgacgtgcgcgagatggagcgcaggctc
gagatactcgccgactacggcaatccacatgccatggtcgacgtcgtagtcaccggctgg
ggggcgctggagtacatcagggacatcgcggccgactacggcatagcggttcacggccac
agggccatgcacgcgaccttcacgagggacccctaccacggcatctcgatgttcgtcttg
gctaagctcctccgcgtcataggcatagaccagctccacgttggaaccgctggtgctggc
aagcttgagggaagcaagtgggacgtcatccagatagccagggtattcagggaggagcac
tacgtccccgatgagactgacgtcttccacatggagcagaagttctaccacatcaggccg
gccatgcccgtcagctcgggcggccttcaccccggcaacatagagcctgttatagacgcc
cttggaaaggacatagttctccagataggcggtggaaccctcggccacccggacggaccg
aaggccggagcgatggccgtcaggcaggccctcgacgccatcatgcagggcatcccgctc
gacgagtacgccaagagccacagggaactcgctagggccctcgaaaagtggggccacgtc
accccggtctga

DBGET integrated database retrieval system