KEGG   Thermococcus sp. 5-4: CDI07_08070Help
Entry
CDI07_08070       CDS       T05088                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
thh  Thermococcus sp. 5-4
Pathway
thh00030  Pentose phosphate pathway
thh01100  Metabolic pathways
thh01120  Microbial metabolism in diverse environments
thh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CDI07_08070
Enzymes [BR:thh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CDI07_08070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ASA78252
UniProt: A0A1Z2TP74
LinkDB All DBs
Position
complement(1456853..1458670)
Genome map
AA seq 605 aa AA seqDB search
MFAYWGKILRVNLTDGTIKEEHFDEEFAKKWLGTRGFGIYFLLKEMDPTADPLSPENKII
YTTGPLTGTTAPTGGRYMVITKSPLTGYIAMANSGGFFGAELKFAGWDAIIVEGASDHPV
YLYINDESVELRDASHLWGKTSTETEEALKEEIGDKRIRAALIGPAGENLVKFAAVMNDE
HRAAGRGGVGAVMGSKKLKAIVVRGHKRVEVADRAKFTSVVKEKTDKLRNDPVAGGGLPK
YGTAVLVNIINQNGLYPTKNFQYSQFEYAEEQSGEAMTAKYLIRNKPCYACPIGCGRVNK
LPTLGVTEGPEYESIWALGAHNGINDLASIIHANHMADEYGMDTISLGGTLATAMELYEK
GILKQEDLGEEAPPFRWGNTEVLHYYIEKIAKREGFGDKLAEGGYRLAEMYGHTEYFMGV
KKQELPAYDPRGAEGHGLGYATNNRGGCHIKQYMISPEILGYPYKMDPHDIGDEKVKMVI
LFQDLTALIDAAGLCVFTTFGLGADDYRDMINAATGWDFSTEEYLKIGERIWNAERLFNL
RAGLDPLKEDTLPKRLLEEPVRNGPNKGHVVRLHLMLPKYYKFRGWTEDGKITEEKMKEL
GIEEL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcgtattggggaaaaattttgagagtgaacttgacggacggaaccattaaggaa
gagcactttgacgaggagttcgcgaagaagtggctgggtaccagaggttttggcatatac
ttcctcctcaaggagatggacccaaccgcggacccgctgagcccggagaataagattatc
tacaccaccggcccactgacgggaacgaccgccccgaccggtggaaggtatatggtcatc
accaagagcccgctgaccggttacatcgccatggcaaactccggcggcttcttcggtgcg
gagctgaagtttgccggctgggacgccatcatagttgagggtgcctccgaccacccggtt
tacctgtacatcaacgacgagagtgtcgagctcagagacgcgagccacctctggggcaag
acctcaaccgagaccgaggaggccctcaaggaggagatcggagacaagcgcataagggcc
gcgctcataggacccgccggcgagaacctcgtaaagttcgcggccgtcatgaatgacgag
cacagggcggcaggaaggggcggcgttggagccgtcatgggaagcaagaagctgaaagcc
atcgtcgttcgcggccacaagcgcgttgaggtcgccgacagggcgaagttcacgagcgtc
gtcaaggagaagaccgacaagctgaggaacgaccccgttgcaggcggaggcctgccgaag
tacggaacggccgttctcgtcaacatcatcaaccagaacggcctgtatccgacgaagaac
ttccagtacagccagttcgagtacgcggaggagcagagcggtgaggccatgaccgcgaag
tacctcatcaggaacaagccgtgctacgcctgtccgatcggctgtggcagggtcaacaag
ctcccgacccttggagttaccgagggaccggagtacgagagcatctgggcgctcggtgcc
cacaacggcataaacgacctagcgagcataatccacgccaaccacatggcggacgagtat
ggtatggacaccataagccttggcggaaccctcgcaacggcgatggagctctacgagaag
ggcatcctcaagcaggaagacctcggagaggaggctcccccgtttaggtggggcaacacg
gaggttctgcactactacatcgagaagatcgccaagagggagggcttcggagacaagctg
gccgagggcggctaccgcctggccgagatgtacggtcacaccgagtacttcatgggcgtc
aagaagcaggagcttccggcttacgacccgcgtggagccgagggacacggcctcggttac
gccaccaacaaccgtggcggctgccacatcaagcagtacatgataagtcccgagatactc
ggctacccgtacaagatggacccgcacgacatcggcgacgagaaggtcaagatggtcatc
ctcttccaggacctcacggctctcatcgacgcggcaggactgtgtgtcttcacgaccttc
ggtctcggtgccgacgactaccgcgacatgataaacgccgcgaccggctgggacttctca
accgaggagtacctcaagataggcgagcgcatctggaacgccgagaggctcttcaacctc
cgcgctggtctcgacccgctcaaggaggacaccctgcccaagaggctcctcgaggagccc
gtcaggaacggtccgaacaaggggcacgtcgtcaggctgcacctgatgcttccgaagtac
tacaagttccgcggctggaccgaggacggaaagataaccgaggagaagatgaaggagctc
ggaatcgaagagctctga

DBGET integrated database retrieval system