KEGG   Thiomonas arsenitoxydans: THI_0183Help
Entry
THI_0183          CDS       T02347                                 

Gene name
mrdA
Definition
(GenBank) Penicillin-binding protein 2 (PBP-2) (mrdA)
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00550  Peptidoglycan biosynthesis
thi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:thi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    THI_0183 (mrdA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    THI_0183 (mrdA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:thi01011]
    THI_0183 (mrdA)
Enzymes [BR:thi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     THI_0183 (mrdA)
Peptidoglycan biosynthesis and degradation proteins [BR:thi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   THI_0183 (mrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: CAZ86937
UniProt: D6CQP6
LinkDB All DBs
Position
182918..185146
Genome map
AA seq 742 aa AA seqDB search
MTELRNIERELFRFRRRLILAAAVVVLSFALLIGRWVWLQVVRHRQFSTQAQDNRIALVP
IPPQRGLILDRNGIILANNYAAYTLEITPSKVKGTLQDTIDALKAIVPITPFDERRFNNL
LGQSRRFQSLPILNKLSDDEVARFVAQRFRFPGVNVRARLFRNYPLGALGCHLLGYIGRI
NQAEQQRIDDSDDASNYLGTDHIGKLGVEQAYETQLHGITGYEEVEVNAVGRPVRKIKTV
AATPGQNLVLGVDIRLQKLIEDLYGKRRGACVAIDPRNGEVLSFVSMPTFDPNLFVDGID
QVNWDALNTSPDRPLLNRVLRGTFPPGSTYKPYLATGALTDGIRTAQWSFHDPGFFMFAG
HRFRDDVPGGHGIVDMHKAIQVSCDVYFYMVAHDWGVDGMAKWTQQFGFGQATGIDLKGE
AKGVLPSREWKRKAFRSPAQQRWYPGDTISLGIGQGYNSFTPLQMATALSTLANQGTRYE
PRVVRAIEDMGTRRFTPVVAPVAQRIDLDPAYWQVVHGGMMAVNQTGGTAAEAFKGAPYT
TAGKTGTAQVFSVGQNQTYDAKDIAHHLRDHALYVVYAPADNPVIALAMIVENAGFGGVA
AAPIARKALDYHLLGLYPTDEEIEKISGAKPQPVQFAYAGEREGVPIIPGAKPPPVPATS
APAGAASGTASGAAAMGAAGVAAKPAPAPAAASSARAQPTAFDAEAVGNYPQTACTGGLR
APLFTRFGARPDVSDESEGVRL
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctgcgcaacatcgaacgcgagctgttccgctttcgccgccgcctgattctg
gccgcggccgtggtggtgctgagctttgcgctgctgatcggtcgctgggtgtggctgcag
gtggtgcggcatcggcagttttcgacccaggcgcaggacaaccgcattgcgctggtgccg
atcccgccgcagcgcgggctgattctcgaccgcaacggcatcatcctggccaacaactac
gcggcttacacgctggaaatcacgccgtcgaaggtgaagggcacattgcaggacaccatc
gatgcgctcaaggccatcgtgcccatcacgcctttcgacgagcggcgcttcaacaatctg
ctggggcagtcgcggcgctttcagtcgctgccgattctcaacaagctcagcgatgatgag
gtggctcgcttcgtggcgcagcgctttcgttttccgggcgtgaatgtgcgggcaaggctg
tttcgcaactatccgctgggcgcgctgggctgccatctgctgggctatatcggccgcatc
aaccaggccgagcagcagcgcatcgacgacagtgacgacgccagcaactacctcggcacc
gaccatatcggcaagctgggcgtggagcaggcttacgagacgcagctgcacggcatcacc
ggctatgaggaagtcgaggtcaatgccgtggggcggccggtgcgcaagatcaagaccgtg
gcggccacgcccggacagaatttggtgctcggagtcgatatccgcctgcaaaagctcatc
gaagacctctacggcaagcggcgcggggcttgcgtagccatcgatccgcgcaacggtgaa
gtgctgagcttcgtctccatgcccacctttgatcccaatctgttcgtcgacggcatcgat
caggtcaactgggacgcgctcaacacctcgcccgaccggccgctgctcaaccgcgtgttg
cgcggcacctttccgccgggctcgacttacaaaccttatctggcgacgggcgcgctgacc
gacggcatccgcaccgcgcagtggagctttcacgaccccggttttttcatgttcgccgga
caccgttttcgcgatgacgtgccaggcgggcatggcatcgtcgacatgcacaaggccata
caggtgtcgtgcgacgtgtatttctatatggtcgcgcacgattggggcgtggacggcatg
gccaagtggacgcagcagttcggcttcggtcaggccaccggcatcgatctcaagggcgag
gccaagggcgtgctgccttcgcgcgagtggaagcgcaaggcctttcgcagcccggcgcag
cagcgctggtatcccggcgacaccatcagtctgggcatcggccagggctacaacagcttc
accccgctgcagatggccacggcgctgtccacgctggccaatcagggcacgcgctacgag
ccgcgcgtggtgcgtgcgatcgaagacatgggcacgcgccgcttcacgccggtggtcgcg
ccagtggcccagcgcatcgacctcgatccggcgtactggcaggtggtacacggcggcatg
atggcggtgaaccagaccggcggcacggcggcggaagccttcaagggcgcgccttacacc
acggcgggcaagaccggcaccgcgcaggtgttcagcgtgggacaaaaccagacctatgac
gccaaggacatcgcccatcatctgcgcgaccatgcgctgtacgtggtttacgccccggcc
gacaacccggtgatcgccctggcgatgatcgtggagaacgccggatttggcggggttgcg
gccgcgcccatcgcgcgcaaggcgctcgactatcacctgctgggcctctaccccaccgac
gaggaaatcgagaagatcagcggcgccaagccgcagccggtgcagtttgcctacgcgggc
gagcgtgaaggcgtgccgatcattcctggcgccaagccaccgcctgttccggcgacatcc
gccccggcgggcgctgcttctggaactgcttctggagccgccgcaatgggggccgcagga
gttgcggcgaagcccgcacctgcaccggcggctgcgtccagcgcgcgcgcccagcccacc
gccttcgatgcggaggccgtgggcaactatccgcaaaccgcctgcacgggcgggctgcgc
gcgccgctgttcacccgcttcggcgctcggcccgatgtgagtgatgaatcggaaggagtg
aggctatga

DBGET integrated database retrieval system