KEGG   Thiomonas arsenitoxydans: THI_0335Help
Entry
THI_0335          CDS       T02347                                 

Definition
(GenBank) putative Peptidase S11, D-alanyl-D-alanine carboxypeptidase 1
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00550  Peptidoglycan biosynthesis
thi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    THI_0335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:thi01002]
    THI_0335
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:thi01011]
    THI_0335
Enzymes [BR:thi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     THI_0335
Peptidases and inhibitors [BR:thi01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   THI_0335
Peptidoglycan biosynthesis and degradation proteins [BR:thi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   THI_0335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: CAZ87085
UniProt: D6CR44
LinkDB All DBs
Position
337601..338782
Genome map
AA seq 393 aa AA seqDB search
MAQAAPTPAAAPAATTPAPSAAAAPLTPMQAMLATVPPPKLDARAWLVVDLTSGQILAEH
DAHAQEAPASLTKLMTAYLTFKALKEGTIKLNQMVTESKEAWQTGGSRMFIDPRVPVSVN
DLLLGMIVQSGNDAAMTLAQTVGGSVSAFVAMMNRQAQQWGLKGTHFMDPTGLPDPGHHT
TAYDLSIIATHIIRDFPADYARYFKVKEFTYNHITQPNRVSLLFTDPSVDGMKTGYTSEA
GYCMITSALRQFPNGPRRLLTVVMGTPTERARGEESQVLLNWAYQNFDDIVLASPGKPVL
TAPVWKGVDNKVELGSSVPVVISVPRGMGKDLQTKVVRPDPLVAPLQAGQRVGQLDVSMS
GKPLAVYPLEVIKAVPEAGLFGRAWDSLRLMIK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcaggccgcccccactccagcggcagctcccgccgcaacgactccggccccgagt
gccgcagccgctcccctcacgccgatgcaggccatgctggccaccgttccgccgcccaag
ctcgatgcgcgggcctggctggtggtcgatctgaccagcggacagatcctcgccgagcac
gacgcccacgctcaggaggcgccggcctcgctgaccaagctgatgacggcttacttgacc
ttcaaggccttgaaagaaggcaccatcaagctcaaccagatggtgaccgaatcgaaagag
gcctggcagaccggtggctcgcgcatgttcatcgacccgcgagtgccggtgtcggtcaac
gacctgctgttgggcatgatcgtgcaatcgggcaatgacgccgcgatgacgctggcgcag
acggtgggcggctcggtgagcgccttcgtcgccatgatgaaccgccaggcgcagcagtgg
ggtcttaagggcacgcatttcatggacccgacgggcttgcccgaccccggccaccacacc
acggcgtatgacctctccatcatcgctacccacatcatccgcgactttccggccgattac
gcgcgctatttcaaggtcaaggaattcacctacaaccacatcacccagcccaaccgcgtc
agcctgctgttcaccgatccttccgtggacggcatgaaaacgggttacacctccgaggcg
ggttactgcatgattacctcggcgctgcgccaatttcccaacggcccgcgtcgcctgctc
accgtggtgatgggcacacccaccgagcgggcccgcggcgaggagagccaggtgctgctc
aactgggcttatcagaacttcgacgacatcgtgctggcctcgcccggcaagccggtactg
actgcgcccgtctggaagggcgtggataacaaagtggaactgggctcctcggtgccggtg
gtcatttcggtgccgcgcggcatgggcaaagaccttcagaccaaggtggtgcggcccgac
ccgctggtggcgccgctgcaggccgggcagcgcgtcggccaactcgacgtgagcatgagc
ggcaagccgctggcggtctatccgctggaggtcatcaaggccgtgcccgaagcgggtctg
ttcggccgcgcttgggacagcttgcgcctgatgatcaagtag

DBGET integrated database retrieval system