KEGG   Thiomonas arsenitoxydans: THI_0397Help
Entry
THI_0397          CDS       T02347                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00550  Peptidoglycan biosynthesis
thi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:thi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    THI_0397
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    THI_0397
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:thi01011]
    THI_0397
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:thi03036]
    THI_0397
Enzymes [BR:thi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     THI_0397
Peptidoglycan biosynthesis and degradation proteins [BR:thi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   THI_0397
Chromosome and associated proteins [BR:thi03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    THI_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer ADH_N_2
Motif
Other DBs
NCBI-ProteinID: CAZ87147
UniProt: D6CRA6
LinkDB All DBs
Position
401970..403760
Genome map
AA seq 596 aa AA seqDB search
MKNPAMRAPKSAASYGKSPLLNVKLPPGRAWLVKGLLFAAFAALGLRAFWVQVWTTQFYQ
NQGDLRFVRTIELPAMRGRILDRNGNILASSIPAKTIWADPTQVESGNDKVQQLARLLGL
NAADLQRRLDSNKQFVYLKRQVDIDVAKEVKALGIKGIYESPSYKRYYPEGSAAAQLIGF
SNIEGQGQDGMELALQARLAGHPGVRKVVKDRLGNVIEDVSGGVPPVDGQDVRLSIDSKI
QYLTYQALKQSVEDNKAKNGSAVVIDAKTGEILAMANYPSFDPNTRKRMTEADIRNYAVT
DAFEPGSVLKPITLSAALQAGIITPTTVFHTAPGCQQFYGANICDDSNNGNIELPQVIQY
SSNVATSQVVSKMPAQVQWNMYTAVGFGQRPQIEFPGATSGLMRPMKRWRPIDRITMGFG
YGLGISTLQLAHAYLIFADRGRIFPVTLFKHDEAPEGVQVVSPTVAREMRGMLALVTQPG
GTAPAAAVPGYSTGGKTGTAWIAKDGKYDKKLFRAQFVGLAPIHHPVLVMAVSVDQPTGG
KHFGGQVSAPVFGAVVPQALRILGVQPDLPVKPDLVPAQTAQALQLPAGRAMKGGA
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatccggctatgcgtgcgcccaagtcggcagccagctatggcaagagcccgctg
ctgaatgtgaagttgccgccaggtcgcgcctggctggtgaaggggctgctgtttgcggcg
tttgcggcgctgggtctgcgcgccttctgggtgcaggtgtggacgacgcagttctatcag
aaccagggcgatctgcgctttgtgcgcaccatcgagctgccggcgatgcgcggccgcatt
ctcgaccgcaacggcaacattctggcgtcgagcattccggccaagaccatatgggccgat
cctacgcaggtcgagtcgggcaacgacaaggtgcagcaactcgcccggttgctcggcctg
aacgccgccgatcttcagcgccggctcgactccaacaaacagttcgtctatctcaagcgg
caggtggacatcgacgtggccaaggaggtcaaggcgctgggcatcaagggcatttatgaa
tcgcccagctacaaacgctactacccggaaggctcggcggcggcgcagctcatcggcttt
tccaatatcgaaggccaggggcaggacggcatggagctggcgctgcaagcgcggctggcc
gggcaccccggggtgcgcaaggtcgtgaaagaccggctgggtaatgtgatcgaggatgtg
tcgggcggcgtgccgccggtggacggacaggatgtgcgcctgtcgatcgacagcaagatc
cagtacctcacctaccaggcgctcaagcagtcggtcgaggacaacaaggccaagaacggc
agtgcggtggtgatcgatgcgaaaacgggagagattctggcaatggccaactaccccagc
ttcgatccgaatacccgcaagcgcatgaccgaggcggacatccgcaactacgccgtgacc
gatgcctttgaaccgggctcggtgctcaagcccatcaccctgagcgcagccttgcaggcc
ggcatcatcaccccgacgacggtgttccataccgcgccgggctgccagcagttttacggc
gccaatatctgcgatgacagcaacaacggcaatatcgaactgccccaagtcatccagtat
tcgagcaacgtcgccacttcgcaggtggtgagcaagatgccagcgcaagtgcagtggaat
atgtacaccgcggtgggcttcggccaacgtccgcagatcgagtttcccggcgcgaccagc
gggctgatgcggcccatgaaacgctggcgcccgatcgaccgcatcaccatgggtttcggt
tacgggttgggtatctccaccctgcagctggcgcatgcctatctcatcttcgccgaccgt
ggccgcattttcccggtcaccctgttcaagcacgatgaggcgcccgaaggcgtgcaggtc
gtctcgcccaccgtggcgcgcgaaatgcgcggcatgctggcgctggtgacgcagcccggc
ggcaccgcaccggcggcggccgtgccgggctactccaccggcggcaagaccggcaccgcc
tggattgccaaggatggcaagtacgacaaaaagctgttccgggcgcaattcgtcgggctg
gcgccgatccaccatccagtgctggtgatggcggtttcggtcgatcaaccgacgggtggc
aagcacttcggcggtcaggtgtcggctccggtgttcggtgcggtggtgccgcaggcgctg
cgcattctcggggtacagcccgacctgccggtcaagcccgatctcgttcccgcgcaaacc
gcgcaagccctgcaactcccggcgggccgggcgatgaaggggggcgcatga

DBGET integrated database retrieval system