KEGG   Thiomonas arsenitoxydans: THI_0404Help
Entry
THI_0404          CDS       T02347                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B (D-alanylalanine synthetase B) (D-Ala-D-Ala ligase B)
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00473  D-Alanine metabolism
thi00550  Peptidoglycan biosynthesis
thi01100  Metabolic pathways
thi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:thi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    THI_0404 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    THI_0404 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    THI_0404 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:thi01011]
    THI_0404 (ddlB)
Enzymes [BR:thi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     THI_0404 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:thi01011]
 Precursor biosynthesis
  Amino acid ligase
   THI_0404 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 GARS_A ATP-grasp_4 TTL ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CAZ87154
UniProt: D6CRB3
LinkDB All DBs
Position
413220..414356
Genome map
AA seq 378 aa AA seqDB search
MTPWPQIDPRGLGRVAVLMGGLSAEREVSLMSGKGVLAALQSRGVDAFAFDPSVDDLAAL
KSFGAQRAFINLHGRWGEDGTVQGALELLGIPYTGPGVLASALAIDKAMTKRLWHFENLS
TPKWREVGTLIEARAAAAELGFPLIFKATHEGSTLGLKRADSEAEVQAAYLEAARFDSRV
LVEQFIEGDEVTCAVIGAGDQARALPLIRIVAPGGNYDYEHKYFSDDTRYICPSELPADE
EARIQDLVLRSYRTLGCRGWARADVMIRATDRQPFLLEINTSPGMTSHSLVPMAARVAGL
EYADLCLLILSMAALDQPHKGVDPQAAASPALPPEEAIPTPALPTSGEGANTPPPRRGGG
WEGEKPALGRPGGGRSDR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaccccctggccgcaaatcgatccgcgcggtctgggccgggtcgcggtgctcatgggc
ggtctttccgccgaacgtgaggtatcgctgatgtcgggcaagggcgtgctcgccgcgctg
caatcgcgcggggtcgatgcctttgctttcgatccgtcggtggacgacctggcggcgctc
aagtcgtttggtgcgcagcgcgcgttcatcaatctgcatggccgctggggtgaggacggc
acggtgcagggcgcgctggaactgctgggcattccctacaccgggccgggcgtgctggcc
tcggccctggcgatcgataaggccatgaccaagcggctgtggcatttcgagaacctgtcc
acacccaagtggcgcgaggtgggcacgctcatcgaggctcgcgcggcggcggccgagctg
ggctttccgctgattttcaaggccacgcatgaaggctccacgctgggtctgaaacgcgcc
gacagcgaggccgaagtgcaagccgcctatctcgaagccgcacgcttcgacagccgggtg
ctggtggagcagttcatcgagggcgacgaagtgacctgcgcggtaatcggcgcgggcgat
caggcgcgggcgctgccgctcattcgcatcgtcgcccccggcggcaactacgactacgaa
cacaagtatttcagcgacgacacccgctacatctgcccaagcgaattgcctgccgacgaa
gaagcgcgcattcaggatctggtcttgcgcagctatcgcacgttgggctgccgcggctgg
gcgcgggccgacgtcatgattcgcgcgaccgaccgccagccctttctgctggagatcaac
acctcgcccggcatgacctcgcattcactggtgcccatggccgcgcgcgtggccgggctg
gaatacgccgatctgtgtctgctcatcctcagcatggcggcgctcgatcaaccgcataag
ggggttgacccccaagctgcggcttcgcctgcgctgccccccgaggaggccatccccacc
ccggccctccccacaagtggagagggagcaaacactcctcccccacgccgtgggggaggt
tgggagggggaaaagcccgccttggggcggcccggcggcgggaggagcgaccgatga

DBGET integrated database retrieval system