KEGG   Thiomonas arsenitoxydans: THI_0486Help
Entry
THI_0486          CDS       T02347                                 

Gene name
aldB
Definition
(GenBank) aldehyde dehydrogenase B
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00010  Glycolysis / Gluconeogenesis
thi00620  Pyruvate metabolism
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THI_0486 (aldB)
   00620 Pyruvate metabolism
    THI_0486 (aldB)
Enzymes [BR:thi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     THI_0486 (aldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: CAZ87229
UniProt: D6CRI8
LinkDB All DBs
Position
494053..495573
Genome map
AA seq 506 aa AA seqDB search
MDMLEPGKFGTAVAFKKRYGNYIGGEWVAPAGGQYFENISPVTGRPFCEIPRSTAPDIEH
ALDAAHKAKGAWGRTSPTDRANILNKIADRMEANLPMLAAAETWDNGKPIRETTLADLPL
AVDHFRYFASCVRSQEGGISEIDHDTYAYHYHEPIGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPVSILVLVELVGDLLPPGVLNVVNGFGLEAGKPLASSSRIGKIAFTG
ETTTGRLISQYASQNLIPVTLELGGKSPNIFFADVMDKDDGYFDKALEGFAMFALNQGEV
CTCPSRALIQESIYDRFMERAIKRVAAIKQGNPLDMDTMIGAQASSEQLEKIVSYLDIGK
QEGAQVLIGGERNKLPGDLEGGYYVKPTVFKGNNKMRIFQEEIFGPVLSVTTFKDEEEAL
EIANDTLYGLGSGVWTRDMNRAFRMGRGIQAGRVWTNCYHLYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSESKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggatatgcttgaacccggtaagtttggtaccgctgttgccttcaaaaagcgttacggc
aactacattggcggcgaatgggttgcccctgccggtggccaatatttcgaaaacatttcg
cccgttactggcaggccgttctgcgagatcccgcgttcgaccgcacccgatatcgaacat
gcgctcgatgcggcgcacaaggctaaaggagcctggggccgcacatcgcccacggaccgg
gcaaatatcctgaacaagattgccgaccgtatggaagccaatctccccatgctggctgcc
gccgagacctgggacaacggaaaacccatccgcgaaacaacgctggcggatctgcccctc
gctgtcgatcacttccgctatttcgcgtcgtgcgtgcgttcccaggaaggtggcatcagc
gagattgaccatgacacctacgcctaccactaccacgagccgatcggcgtggttgggcag
atcattccctggaactttccgattctgatggcagtctggaaactggcgcccgcgttggct
gcgggaaactgcgttgtgctcaagcccgccgagcaaacgccggtgtccatcctggtgctc
gtggaattggtcggggacctcctgcctccgggcgtcctcaacgtggtcaacggcttcggc
ctggaagcgggcaagccattggcatcgagcagccgcatcggcaagatcgccttcacgggc
gagacgaccaccggccgcctgatttcgcagtatgcgagccagaacctgattcccgtgaca
ctggaactgggtggcaaatcgccgaacatcttctttgccgatgtgatggacaaggacgat
ggctacttcgacaaggcgcttgaaggcttcgcgatgttcgcgctcaaccagggtgaagtc
tgcacctgcccgtcgcgcgcgttgatccaggagtcgatctatgaccgattcatggagcgc
gcaatcaagcgcgtagcagcaatcaagcagggaaatccgctggatatggacaccatgatc
ggcgcgcaggcgtcaagcgagcaactggagaagatcgtttcatatctcgacattggcaaa
caggagggtgcccaggtgctgattggcggtgagcgcaacaaactcccgggagacctcgaa
ggcggctattacgtcaagcccacggtcttcaaagggaacaacaaaatgcgcattttccag
gaggagatcttcggccctgtcctgtccgttaccaccttcaaggacgaggaagaagcactg
gaaatcgctaatgacacgctgtatggactgggctcgggggtctggacgcgcgacatgaat
cgggcgttccgcatgggccgcggcatccaggctggccgcgtctggacgaattgctaccac
ctttaccctgcccatgcggcattcggtggttacaagcaatcgggtatcggacgcgaaaac
cacaagatgatgctcgaccattatcagcagaccaagaacctgctagtgagctacagcgaa
agcaaactgggcttcttttga

DBGET integrated database retrieval system