KEGG   Thiomonas arsenitoxydans: THI_1672Help
Entry
THI_1672          CDS       T02347                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00020  Citrate cycle (TCA cycle)
thi00310  Lysine degradation
thi00380  Tryptophan metabolism
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01120  Microbial metabolism in diverse environments
thi01130  Biosynthesis of antibiotics
thi01200  Carbon metabolism
Module
thi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
thi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:thi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THI_1672 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    THI_1672 (sucB)
   00380 Tryptophan metabolism
    THI_1672 (sucB)
Enzymes [BR:thi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     THI_1672 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: CAZ88348
UniProt: D6CSS9
LinkDB All DBs
Position
1660000..1661310
Genome map
AA seq 436 aa AA seqDB search
MALIDIKVPQLSESVAEATLLTWKKKPGEPVAQDEILIEIETDKVVLEVPAPEAGVMAQI
VKNDGELVTSDEVIAKIDTEAKPQTSPLPVAPVKAAEPAASAPTAIASAVAPAAPSAGAA
VAMPAAAKIMAEQGVNPSDVAGTGRGGRITKGDALQAAAAPKPPTVPAPTPAPKPATAAA
AMPSLTIPALQPVEADLDLAAYTDRPEQRVPMSRLRARIAERLLQSQATNAILTTFNEVN
MKPVIDMRNLYKDKFEKQHGVKLGFMSFFVRAAVHALRKFPLLNASIDGNDIVYHGYFDI
GIAVGSPRGLVVPILRNADQMSFADIEKAIADFGAKARDGKLTIEELTGGTFSISNGGVF
GSMLSTPIINPPQSAILGIHATKDRPVVEDGQIVIRPMNYLAMSYDHRLIDGREAVLGLV
AMKEALEDPARLLLDL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgatcgacatcaaagttccccaactctccgaatccgtggctgaagccactctg
ctgacctggaagaaaaagcccggcgaacccgtggcgcaggatgaaatcctgattgaaatc
gagaccgacaaagtggtgctcgaagtgcccgctcccgaagccggggtgatggcgcagatc
gtcaagaacgacggcgaattggtgaccagcgacgaagtcatcgccaagatcgacactgaa
gccaagccgcagaccagcccgttgcccgtggcgccagtcaaggcggctgaaccggctgct
tcggctccgaccgcgattgcatctgcagttgcgcctgcggcgccctccgcaggcgcggcg
gtggctatgccggctgcggcgaagatcatggccgagcagggcgtgaatccgtcagacgtg
gcgggcaccgggcgcggcggccgcattaccaagggcgatgccttgcaggctgcggctgcg
cccaagccgccgaccgttccagccccaacgcccgcgccgaaaccggcgaccgctgcggcc
gcaatgccctcgctcactatccccgcgttgcagccggtggaggccgatctcgatctcgcc
gcctacaccgaccggcccgaacagcgcgtgccgatgagccgcctgcgcgcgcgcatcgcc
gaacggctgctgcagtcgcaggccaccaacgccatcctcaccaccttcaacgaagtgaac
atgaagccggtgatcgacatgcgcaatctgtacaaagacaagttcgagaagcagcacggc
gtgaagctgggtttcatgagcttttttgtgcgcgccgcggtgcatgcgctgcgcaagttc
ccgctgctcaacgcctcgatcgacggcaatgacatcgtctatcacggctacttcgacatc
ggcatcgccgtgggcagtccgcgcgggctggtggtgcccattctgcgcaatgccgatcag
atgagttttgccgacatcgaaaaagccatcgccgattttggtgccaaggcacgtgacggc
aagctgaccatcgaggagctcaccggcggcaccttctccatcagcaacggcggagtgttc
ggctcgatgctgtccacgcccatcatcaatccgccgcagtcggccattctgggcatccac
gccaccaaagaccgacccgtggtcgaagacggtcagatcgtgattcgcccgatgaactac
ctggcaatgagctacgaccatcgcctgatcgacggccgcgaagcggtgctcggcctggtg
gcgatgaaagaggcgctcgaagaccccgcgcgtctgctgctcgatctttga

DBGET integrated database retrieval system