KEGG   Thiomonas arsenitoxydans: THI_2564Help
Entry
THI_2564          CDS       T02347                                 

Definition
(GenBank) putative ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi03030  DNA replication
thi03410  Base excision repair
thi03420  Nucleotide excision repair
thi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:thi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    THI_2564
   03410 Base excision repair
    THI_2564
   03420 Nucleotide excision repair
    THI_2564
   03430 Mismatch repair
    THI_2564
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:thi03032]
    THI_2564
   03400 DNA repair and recombination proteins [BR:thi03400]
    THI_2564
Enzymes [BR:thi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     THI_2564
    6.5.1.6  DNA ligase (ATP or NAD+)
     THI_2564
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     THI_2564
DNA replication proteins [BR:thi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    THI_2564
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     THI_2564
DNA repair and recombination proteins [BR:thi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     THI_2564
   NER (nucleotide excision repair)
    Other NER factors
     THI_2564
   MMR (mismatch exicision repair)
    Other MMR factors
     THI_2564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: CAZ89183
UniProt: D6CV64
LinkDB All DBs
Position
2519276..2520166
Genome map
AA seq 296 aa AA seqDB search
MRPSPRRFPAPTLAGLRPLLLCGVLLTNLPWAQAEAPSPPPPALLLAETASSQLDPAPYW
VSEKLDGVRAFWDGRVLRFRSGNPVPAPAWFTAALPSQPLDGELWIARESFDQVSGIVRS
NPPNDRDWKQVRYMVFELPNAPGSFTERIARMRTLVERAQAPWLQMVPQFRVPNSAALKQ
QLDKIVKAGGEGLMLHRADAPYQTGRQDVLLKLKPWQDAEATVIGYTPGKGKYAGLTGAL
NMQMPDGKIFRIGSGLSDALRRNPPPIGAQITYRYQSLTPSGLPRFARYLRVREKE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccttcgccacgccgctttccagcacccactctcgctgggctgcgcccgctgttg
ctgtgtggcgtgctgctgacgaatctgccctgggcgcaggccgaagcgcccagcccgcca
cccccggctctgttgctggccgaaaccgcctcaagccagctcgatccggcgccctactgg
gtgagcgaaaaactcgacggcgtgcgcgccttctgggacggtcgggtgctgcgttttcgc
agcggcaacccggtgcccgctccggcgtggttcaccgccgcgctgccctcgcagccgctg
gacggcgagctgtggatcgcccgcgaaagcttcgaccaggtctcgggcatcgttcgcagc
aacccgcccaacgaccgcgactggaagcaggtgcgttacatggtgttcgagttgcccaat
gcgccgggcagcttcaccgagcgcatcgcccgcatgcgcacgctggtggaacgggcgcag
gcaccctggctgcaaatggtgccgcagttccgcgtgcccaactccgccgcgctcaagcag
cagctcgacaaaatcgtgaaggcaggcggcgagggcctgatgctgcaccgcgccgatgcg
ccgtatcaaaccggccgtcaggatgtgctgctcaagctcaagccctggcaggacgccgaa
gccaccgtcatcggctacacgccgggcaaaggcaaatatgcggggctgaccggcgccctg
aacatgcagatgcccgacggcaagatctttcgcatcggttccggcctgagcgacgccctg
cgccgcaacccgccgcccatcggcgcccagattacctaccgctaccagtcgctcacgccc
tcgggccttccacgttttgcgcgctaccttcgcgtgcgcgagaaagaatga

DBGET integrated database retrieval system