KEGG   Thiomonas arsenitoxydans: THI_2726Help
Entry
THI_2726          CDS       T02347                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F (Alkyl hydroperoxide reductase F52A protein)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
thi  Thiomonas arsenitoxydans
Brite
KEGG Orthology (KO) [BR:thi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    THI_2726 (ahpF)
Enzymes [BR:thi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     THI_2726 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA Thioredoxin_3 HI0933_like DAO FAD_oxidored FAD_binding_2 AlaDh_PNT_C NAD_binding_8 Glutaredoxin NAD_binding_7 K_oxygenase FAD_binding_3 Thi4 GMC_oxred_N FMO-like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CAZ89339
UniProt: D6CLB1
LinkDB All DBs
Position
complement(2681635..2683224)
Genome map
AA seq 529 aa AA seqDB search
MLDDTLLSQLKAYLERVSQPFTLVASLDDSENAAQMRTLLEQIASLSDKISVRFDGTDAR
RPSFALERVSGPAQHLRFAAIPLGHEFTSLVLALLWTGGHPPKVEAETLEAIRQLDGDYR
FEVYMSLSCHNCPDVVQALSLMAVFNPRVQTVVIDGALYQSEVESRQIMAVPTVYLNGEL
FGSGRMDVEEIVAKLDTGSAQRDAAKLNAKAPYDVLIVGGGPAGAAAAVYAARKGIRVGL
AAERFGGQVNDTLAIENYISVLETDGPKFGMALEAHVRQYGVEILNQQRAEKLIPAEHEG
GLIGVQFAHGGRLQARSVILSTGARWRNVNVPGEAQYRNKGVAYCPHCDGPLFKGKRVSV
IGGGNSGVEAAIDLAGLVAHVTLLEFAPELRADAVLVSKLRSLPNVTIHTNAQTTEITGD
GSKVNGLTYTDRASGASHHLELEGVFVQIGLVPNTEWLKGVVELSRFGEIVVDAKGQTSV
PGIMAAGDVTTVPYKQIVIAAGDGAKAALSAFDYLIRTPAPQMAEAVAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgacaccctgctttcccaactcaaggcttacctggagcgcgtctctcagcca
ttcacccttgtcgcctctctggacgatagcgagaacgcggcgcagatgcgcaccctgctg
gagcagatcgcgagcctgtccgacaagatttcggtgcgattcgacggcaccgacgcgcgg
cgcccgtccttcgctctggagcgtgtctcgggcccggcgcagcatctgcggtttgccgcg
attcctctgggccatgagttcacctcgctggtgctggcgttgctgtggactggcggccat
ccgcccaaggtcgaggctgagaccctcgaggcgattcgccagctcgacggcgactatcgc
ttcgaggtgtatatgtcgctgagctgccataactgcccggacgtagtgcaggcgctgtcg
ctcatggcggtgttcaacccgcgcgtgcaaacggtggtgatcgacggtgcgctgtatcag
agcgaggtcgagtcgcggcagatcatggcggtgcccaccgtgtatctcaatggcgagctg
ttcggcagcgggcgcatggatgtggaggagatcgtcgccaagctcgacaccggctctgcg
cagcgcgacgccgccaagctcaacgccaaagcgccttacgacgtgctgattgtgggcggc
ggccccgctggcgcggctgccgcggtttacgcggcgcgcaagggcattcgcgtggggctg
gcagccgagcgtttcggcggacaggtcaacgacacattggcgatcgaaaactacatctcg
gtgctggaaaccgatggtccgaaattcggcatggcgctcgaagcgcatgtgcggcaatac
ggcgtggagattctcaatcaacagcgcgccgaaaagctcattcccgcagagcacgaaggt
gggttgatcggcgtgcagtttgcccatggcggccgcctgcaggcgcgcagcgtcatcctc
tctaccggcgcgcgctggcgcaatgtgaacgtgccgggcgaagcgcagtaccgcaacaag
ggcgtggcgtactgcccgcattgcgatggcccgctgttcaagggcaagcgggtgagcgtg
atcggcgggggcaactcgggcgtggaagccgccatcgatctggcgggtctggtggcgcat
gtcactctgctggaattcgcgcccgagctacgcgctgacgcggtgctggtgagcaagctg
cgcagcctgcccaacgtcaccattcacaccaacgcgcaaaccaccgaaatcaccggcgac
ggcagcaaggtcaacggcctcacctacaccgaccgcgcaagcggcgccagccatcatctg
gagttggagggcgtgttcgtgcaaatcggcctggtgcccaacaccgagtggctcaaaggc
gtggtcgaactcagccgattcggcgaaattgtggtggatgccaaaggccagacctcggtg
cccggcatcatggcggcgggcgacgtgacgaccgtgccctacaagcagatcgtcatcgcc
gcgggtgatggcgccaaggccgcgctcagcgcctttgactatctcatccgcaccccggcg
ccgcagatggccgaagccgtggccgcctga

DBGET integrated database retrieval system