KEGG   Thiomonas arsenitoxydans: THI_3176Help
Entry
THI_3176          CDS       T02347                                 

Gene name
aor
Definition
(GenBank) Tungsten-containing aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00030  Pentose phosphate pathway
thi01100  Metabolic pathways
thi01120  Microbial metabolism in diverse environments
thi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    THI_3176 (aor)
Enzymes [BR:thi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     THI_3176 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: CAZ89774
UniProt: D6CMJ6
LinkDB All DBs
Position
3089439..3091286
Genome map
AA seq 615 aa AA seqDB search
MTWAGKILRVNLTQGTIKSEPLNRQWAREYIGQRGLATKYFVEEVDAKVDPLSPDNKLIY
ATGPLTGTMASTGGRYSVITKGALTGAIACSNSGGYFGAELKMAGWDMIIVEGKSPKPVY
LSIENDKAELLDASPIWGKTVWETEPWIKNHHQDPLIRVSSIGRAGENGVMYAAIVNDLH
RAAGRSGVGTVMGSKNLKAIAVRGTLGVGNVRDPKAFMAAVNAGKKVLHDNAVTGQGLPK
YGTQVLMNVINEIGALPTRNHRDVQFEGAKDISGEAMHEPRKTDGKPNLVTNQACFGCTI
ACGRISKIDEHHFSVENKPQYWGASGGLEYEAAWALGSANGVNDLEALTYANFLCNEDGM
DPITFGATVGAVMELYDMGLLTKEQLGVEAPFGSAKALTYFAEITARGEGFGKELALGSK
RLTAKYGHPELSMSVKGQEFPAYDSRGIQGMGLAYATSNRGACHLRGYTVASEVLGIPVK
TDPLVADGKPELVKAFQDATAVFDSAGICLFTSFAWTLADVQPQLAAACLEEFTMDELNT
IGERIWNMERDYNNRAGFTAKDDTLPPRLLKEPAKTGPAKGLTNKLPEMLPRYYELRGWT
PEGTLKPETRTRLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgacctgggccggaaaaattctgcgcgtgaacctcacgcaaggcaccatcaagagcgag
ccgctgaataggcagtgggcgcgcgagtacatcggccagcgcgggctggcgaccaagtat
ttcgtcgaggaggtcgacgccaaggtcgatccgctctcgcccgacaacaagctgatttac
gccaccgggccgctcaccggcaccatggcgtccaccggcgggcgctattcggtcatcacc
aaaggcgcgctgaccggcgcaatcgcctgctccaattcgggcggctacttcggcgccgag
ctgaagatggcgggctgggacatgatcatcgtcgaaggcaaatcgcccaagccggtgtat
ctctccatcgaaaatgacaaggccgaactgctcgacgcctcgccgatctggggcaagacc
gtgtgggaaaccgagccctggatcaagaaccatcaccaagacccgctgatccgcgtcagc
tccatcggccgtgcgggtgaaaacggggtgatgtatgcggccatcgtcaacgatctgcac
cgcgccgccggtcgctcgggcgtgggcacggtgatgggtagcaagaacctcaaggccatc
gcggtgcgtggcaccctgggcgtgggcaatgtgcgcgaccccaaggcgttcatggctgcg
gtcaacgcaggcaaaaaagtgctgcacgacaacgccgtcaccggccagggtctgccgaaa
tacggcacccaggtgttgatgaacgtgatcaacgaaatcggcgccctgcccacgcgcaac
caccgcgacgtgcaattcgaaggcgcgaaagacatctccggcgaggccatgcacgagccg
cgcaaaaccgatggcaagcccaatctggtcaccaaccaggcgtgctttggctgcaccatc
gcttgcggccgcatcagcaagatcgacgaacaccatttcagcgtcgagaacaagccgcag
tactggggcgcatcgggcggtctggaatatgaagccgcctgggcgctgggctcggccaac
ggcgtcaacgatctggaggcgttgacctacgccaacttcctctgcaatgaagacggcatg
gaccccatcactttcggcgccaccgtgggcgcggtgatggagctgtacgacatgggcctg
ctgaccaaggaacaactcggtgtggaagcgccattcggctcggccaaggcgctgacctac
ttcgccgaaatcaccgcccgcggcgagggcttcggcaaggaactggcgctgggcagcaaa
cgcctgacggccaagtacggccacccggaactgagcatgagcgtcaagggccaagagttc
ccggcctacgactctcgcggcattcaaggcatgggcctggcctatgcgaccagcaaccgc
ggcgcctgccatctgcgcggttacacggtggcttcggaagtgctgggcattccggtcaag
accgatccgctggtggccgacggcaagcccgaactggtcaaggcgtttcaggacgccacc
gccgtgttcgactctgccggtatctgcctgttcaccagtttcgcctggacgctggccgac
gtgcagccgcagcttgccgccgcctgcctggaagagttcaccatggacgagttgaacacc
ataggcgagcgtatctggaacatggagcgcgactacaacaaccgcgcgggcttcaccgcc
aaggacgacaccttgccgccgcgtctgctcaaagagcccgccaagaccggcccggccaag
gggctgaccaacaagctgcccgaaatgctgcctcgctattacgaactgcgcggctggact
ccggaaggcacgctcaagcccgaaacccgcacgcggctcgggctttga

DBGET integrated database retrieval system