KEGG   Thiomonas arsenitoxydans: THI_3254Help
Entry
THI_3254          CDS       T02347                                 

Definition
(GenBank) putative Thioesterase/thiol ester dehydrase-isomerase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00061  Fatty acid biosynthesis
thi00780  Biotin metabolism
thi01100  Metabolic pathways
thi01212  Fatty acid metabolism
Module
thi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:thi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    THI_3254
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    THI_3254
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:thi01004]
    THI_3254
Enzymes [BR:thi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     THI_3254
Lipid biosynthesis proteins [BR:thi01004]
 Fatty acid synthase
  Component type
   THI_3254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: CAZ89850
UniProt: D6CMS2
LinkDB All DBs
Position
complement(3170647..3171165)
Genome map
AA seq 172 aa AA seqDB search
MASLLSYPIELDAQAIEEVLPHRGEILCVRRITVLDFNHYVGHVIWARDLPILQGHFPGM
PMVPGALLIEAVAQVAGAGMLVGDVLARSMRGSHVGVLAGVRKCSFKRPVQCDEWVRIEV
RSRQMSATAAAISAQLQIGAEEVAGIEILLVNTPRTVLIDTLPAAPRGAEMG
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcctctctcttgtcctatcccatcgagctcgacgcgcaagccatcgaagaggtgctg
ccgcatcgtggcgaaatcctatgcgtccggcggatcaccgtgctggatttcaaccattac
gtcggccatgtcatctgggcgcgcgacctgcctattctgcaagggcacttccccggcatg
cccatggtgcccggcgccctgctgatcgaggcggtggcccaggtggctggagccgggatg
cttgtcggcgacgtgcttgcgcgcagcatgcgcggcagccacgtgggcgtgctggcaggc
gtgcgcaaatgcagtttcaagcgcccggttcaatgcgatgaatgggtacggatcgaggtg
cggtccaggcagatgtcggccacggctgccgccatttcagcccaattgcagatcggcgca
gaagaagtcgccggcatcgagatcctgctggtcaacacgccgcgtactgtgttgatcgat
accctgcccgcggcaccacgcggtgcggaaatggggtaa

DBGET integrated database retrieval system