KEGG   Candidatus Thioglobus sp. NP1: CRN91_06480Help
Entry
CRN91_06480       CDS       T05818                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
thin  Candidatus Thioglobus sp. NP1
Pathway
thin00550  Peptidoglycan biosynthesis
thin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thin00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CRN91_06480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:thin01002]
    CRN91_06480
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:thin01011]
    CRN91_06480
Enzymes [BR:thin01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CRN91_06480
Peptidases [BR:thin01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   CRN91_06480
Peptidoglycan biosynthesis and degradation proteins [BR:thin01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CRN91_06480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 DUF1381
Motif
Other DBs
NCBI-ProteinID: AXE62300
UniProt: A0A344WA65
LinkDB All DBs
Position
1262682..1263827
Genome map
AA seq 381 aa AA seqDB search
MKSNALLKSLQLIFLFLFAFNVHADEPRFYIPDAPPIDASSYALMDHNSKSMLAANNENQ
RRSPASLTKIMTSYVIFKRLKEEFITLDDEVKISEKAWRTGGSRSFIEVGKIIRLEDLLK
GMIIQSGNDASVALAEHVAGSEGTFVLFMNDYAQQLGMTNSRFENSSGLPHEEQYTTAKD
MAILSSAMIEEFPEFYKWYSEKEFTYNNITQTNRNKLLFTDSTVDGLKTGWTQMAGYCLV
TSANRVGMRLITVVMGSASPAARTIETEKLLDYGFRFFETQSVNDISHQVPVYKSKKANI
KVGVAESSYLTLPRNQFKYTTQTINLSGDLIAPITKGDEVGTLAISFNNKNIATLPLVAL
DNAIEGGFLTKMVDTVKLLFR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaaacgccttgcttaaatctttacaattaatatttttattcttatttgcattt
aatgttcatgcagatgagccacgtttttatatacctgatgcacctccaattgatgcaagc
tcgtatgctcttatggatcataattctaaatccatgctagctgccaataatgaaaaccaa
agaaggtcgcctgccagcttaacaaaaattatgacctcttatgtcatctttaaaaggctt
aaagaggaattcataactctcgatgatgaagttaaaattagcgaaaaagcatggagaact
gggggctctagaagttttattgaggttggaaaaataataagacttgaagatttacttaaa
gggatgattattcaatcaggtaatgatgcttcggttgctcttgcagaacatgttgcgggt
tctgaaggtacttttgttctctttatgaatgattatgcccagcaacttggcatgacaaat
tctcgttttgaaaactcttcaggccttccgcatgaagaacaatacacaactgcaaaagat
atggcgattctatcaagcgctatgattgaagaatttccagaattttataaatggtatagt
gaaaaagaatttacttataacaatattacgcagactaatcgaaataaactcctttttact
gatagtactgttgatggacttaaaactggctggactcaaatggcaggatattgcctagta
actagtgctaatagagttggtatgaggcttataactgtagtaatgggctctgcaagccct
gcagcaaggactattgaaactgaaaaacttctggactatggatttcgtttttttgaaaca
caatcagttaatgatatatctcatcaagttccagtttataaatctaaaaaagcaaatatt
aaggttggggttgcagaatcaagttacttgactcttcctcgtaatcaattcaaatacact
actcaaaccataaatctttcgggtgacttgattgctccaattactaagggtgatgaagtt
ggcactcttgcgattagttttaataataaaaatatagcaactcttcctcttgtagcactt
gataatgctattgaaggtggttttttaacaaaaatggttgatactgtaaaacttcttttt
agataa

DBGET integrated database retrieval system