KEGG   Thiomicrospira sp. S5: AYJ59_05185Help
Entry
AYJ59_05185       CDS       T05796                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
thio  Thiomicrospira sp. S5
Pathway
thio00550  Peptidoglycan biosynthesis
thio01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:thio00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AYJ59_05185
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AYJ59_05185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:thio01011]
    AYJ59_05185
Enzymes [BR:thio01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AYJ59_05185
Peptidoglycan biosynthesis and degradation proteins [BR:thio01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   AYJ59_05185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Ntox35
Motif
Other DBs
NCBI-ProteinID: AZR81731
UniProt: A0A3S9TMD2
LinkDB All DBs
Position
complement(1139986..1141806)
Genome map
AA seq 606 aa AA seqDB search
MRHHHHLYQTENEISQQKRLFRARIYFALAFAILFFLVLLGRMTYLQWIGYNHYHSMAEG
NRISVEPIPAVRGRIYDRNHILLADNQPVFVLKFSKDKIEDITETINRLHEILPDLPEQK
LNKFEERLKVSSKYRPIYLPYTLSENEAARFAGNSYQFPGITLVAKLKRTYPFGSAAVHA
LGYVGKINQKEYDGLNESRYAGTDVIGKLGVEKFYEPVLHGFPGLQQVETNARGRVIRKL
ETIPAKPGKDIQLTLDIRLQEYIEKYLDGKKAAVVVTDPKTGDILAYVSSPGYDPNLFVD
GISQTNYKKLLSNHNRPLINRVLNGQYPPGSTIKPFVALAAIENNIISPEKQIFDPGFFE
FKDHRYRDWKRQGHGLVDMNDAIAQSCDTYFYELSLDMGIDLIHDSLYPFGFGHHTGIDL
YNESVGILPSKAWKKNTKGESWYKGETIIAAIGQGYFLATPLQLAKAASIMANRGEVVEP
HLLKGMTEPEKEQIPIQKIKNWEEVIQAMVDVMHGSRGTARRYARDLPFKMAGKTGTAQV
FSLNEAEYDEENIKKSLRDHSLFIGFAPVEKPKIAISVIIENSTLKAAPVAVDIIKYYLT
ELHDEN
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgagacatcaccaccacctgtaccaaacggaaaacgaaatcagccaacagaaacgactt
ttccgtgcccgcatctactttgccttggcctttgccatccttttctttttggtactgttg
gggcgcatgacttacctacagtggattggctacaatcattatcattccatggcggaaggc
aaccggatatccgtggaacccattcccgcggtgcgtggccgtatctacgaccgtaaccac
attcttctagcggacaaccaaccagttttcgtcctgaagttttccaaagataaaatcgaa
gacatcaccgaaaccatcaaccggttacacgagattctgccagacctgcccgagcaaaaa
ctcaacaagtttgaagaacgcctgaaagtttcgagcaagtatcggccaatctatttacct
tataccctttcggaaaatgaagccgcacgctttgccggtaacagctaccaattcccgggc
atcacgctggttgcaaaactcaaacgcacctatcctttcggctccgctgcggtgcatgca
ctgggctatgtcggcaaaatcaatcaaaaggaatacgacggcctgaacgaatcccgttac
gcgggtaccgacgtcatcgggaaactgggcgtggaaaaattctatgaacccgttctccac
ggctttcccggtctacagcaagtggaaaccaatgcacgaggtcgcgtcattcgaaaactg
gaaaccattcccgccaaacccgggaaggacattcagctcaccctcgatatccgcttacag
gaatacatcgaaaaatacctggatggcaaaaaagccgccgtcgtggtcaccgacccgaaa
accggcgacatcctcgcttacgtcagttcgcccggctacgatccgaacctgttcgtggac
ggcatcagccagaccaactataaaaaactgctgtccaatcacaaccgccccctcatcaac
cgggttttgaacggtcaatacccacccggttctaccatcaagccctttgtagccctggcc
gccattgaaaacaacatcatttcccctgaaaaacaaatctttgatcccggctttttcgaa
ttcaaagatcaccgttaccgtgactggaagcgccaagggcatggcctcgtcgacatgaac
gatgccatcgcccagtcctgtgatacctacttttatgaactcagcctggatatgggcatc
gatttgatccacgactcattgtaccctttcggtttcggccaccataccgggatagacctt
tacaatgaatcggtcggcattttgccttccaaggcctggaagaaaaacaccaaaggtgaa
tcctggtataaaggggaaaccatcatcgccgccattggccagggatattttctggccaca
ccattgcaattagccaaagccgcctccatcatggctaaccgcggcgaagtggtcgaacct
cacctactaaaaggcatgaccgaaccggaaaaagaacaaatcccgattcaaaaaattaaa
aattgggaagaagtcattcaggcgatggttgacgtcatgcacggttcgcgaggaactgcc
agacgatacgcacgcgacttgccatttaaaatggccggaaagaccggtaccgctcaagtt
ttcagcttgaatgaagccgaatacgatgaagaaaacattaaaaaaagcctacgcgaccac
tcgctgtttatcggctttgcgccggtggaaaagcctaaaatcgccatcagtgttatcata
gaaaattccacgctcaaggccgcgccggtcgccgtggacatcattaaatattacctgacc
gagttgcacgatgagaattga

DBGET integrated database retrieval system