KEGG   Thiothrix sp. SSD2: HZT40_18115
Entry
HZT40_18115       CDS       T06729                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
this  Thiothrix sp. SSD2
Pathway
this00620  Pyruvate metabolism
this01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:this00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HZT40_18115
Enzymes [BR:this01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     HZT40_18115
SSDB
Other DBs
NCBI-ProteinID: QLQ33187
UniProt: A0A7D6LG47
LinkDB
Position
complement(3574861..3578316)
AA seq 1151 aa
MNMEQSLGLGEARPDAEAERRRLQLYINLKLSSSGQPAAHAGDNEFLSIAHDLLSSYREX
NRLLMNYLCPPDRRIQDFLDSYLEDCPEVGKAHLPSNSIVLDRYGVARELSLPANGDEFR
SDIVSSYRVKQGILHNPANDRRTTKGSFHIAEGGLPIPGDKKAVPKTAYARMLAXALNPP
DDLLALPFTANEEQAARLFVSLLLRPVVCPEIPGVEAEKSMEIRFFAPGNLVSNLDFVES
IFGNAGNPYLPRHDAALDVEHWTSHTGCVILAXHLTRLTKQEXGLPHYGQATERQRRDGM
CWRDENERYNDGNAFKVTXRDTRGVIVTILADNYYGYCKKEVKTQISYSANLFGLAEEEH
AGGALAFQRRNHGEEYGADSRTRQQPEIYNFANTVAQFGEIMDVQPEGYAIDKQFPDVVY
LPLDVRMDLRTQTVRWRNGSGEQVIKLRPGKVYMQPNGYKTEMQRHPAAPSWRIIGTDPE
GTFCHKPCTVSGGGKSEISKSLDDAVIYGXVFVQDFETDMDQVEAIFNRDYSTRLKPECA
HEDRDPRRQPLSKERSLGSFIKLLTPSPGNTDAYNDWLAGIPPRILSQAFIIKRMYKPEW
XDGWRSHFSVDVINGMPGHALKCEGRDLVASYLRVGLGKSGNWHTFKVRQDFIATEKVQM
EDDITASVVVNAAVLPNRSPKSSNPSVKLAKNCEYRLFQRPDEAIHRGFDKQTESDMAQP
GNFIANFEPLHGDGLATLVEDVVEFQLYTAPMRNLLQAACASGEYVVSSANPRLVGGKPS
KNPRYLQVRPDLQQPMRTYIAEIGARFKRRIPLGQPLITEVNGVLSGRRNNPPEPGIRPL
AVFNPIHYQELPELFMDFICSVTGKSPSTTGAGSEGALTKXPFNALRATADLNNTLVSFL
ISGYAGFSSAAGYIGANQRVDHDISLLIPEIWARLNESERDPDYLIGHGYLEKLEDFDYD
GKRVLASRLGYRITDRFVAAFMGKIFDNPAVVFGEDILKPETQGLDVFADGVNNIVEAQQ
QAAQRYLDDGSIDDACPPLKALLYIMATGSFEGKDVRHPAIRALFTRDYLLASRWYQQRL
ETKQQRDVALWERHCRYLQHFLELETHRDVAERLDIAGKLHQAQAKLAAIRTPEYLRSLR
GTIGADLLGAY
NT seq 3456 nt   +upstreamnt  +downstreamnt
atgaacatggaacaatcgctaggtctgggtgaggcgcgcccagacgctgaagcggaacgc
cgccgtctgcaactgtacatcaacctcaagctgtcctcttccggccagcctgccgcccac
gctggcgacaatgaattcctctcgatcgcgcacgacctgctgtccagttaccgtgaanaa
aaccgcttgctgatgaattacctgtgcccgcctgaccggcgcatccaggatttcctcgac
agttacctggaagattgcccggaggtgggcaaggcgcacctgccgagcaacagcatcgtg
ctcgaccgttacggcgtggcgcgggaattgtccctgcccgccaatggcgacgaattccgc
tccgacatcgtgtccagttaccgggtgaaacagggcatcctgcataatccggccaacgac
cgccgcaccaccaaaggttcgttccacatcgctgaaggcggcctgccgattcccggcgac
aagaaggccgtgccgaaaaccgcgtatgcgcgcatgctggccnatgcccttaacccgccg
gacgacctgttggcattgccgttcaccgccaacgaggagcaagcggcgcgcctgtttgtg
tccctgctgctgcgcccggtggtgtgcccggaaatccccggcgtggaggcggaaaagagc
atggaaatccgtttcttcgcccccggcaacctggtcagcaatctggatttcgtcgaaagc
attttcggcaacgcgggcaacccctacttgccccggcatgacgcggcgctggatgtggag
cactggacgagccacaccggctgcgtgatcctggccncacacctgacccgcctgaccaag
caggagncaggcctgccgcattacgggcaggcgaccgaacgccagcggcgggacggcatg
tgctggcgcgacgaaaacgagcgttacaacgatggcaacgccttcaaggtgacggnncgc
gacacacgcggtgtgatcgtcaccatcctggccgacaactactacggctattgcaagaaa
gaggtcaaaacccagatcagctattccgccaacctgttcgggctggcggaggaggagcat
gcaggcggcgcgcttgcgttccagcggcgtaaccatggcgaagaatacggcgcggacagc
cgcacccgccagcagcccgaaatttacaatttcgccaatacggtggcgcagttcggggaa
atcatggacgtgcagccggaaggttacgccatcgacaaacagtttccggatgtggtctac
ctgccgctggacgtgcgcatggatttgcgcacccaaaccgtccgctggcggaacggttcc
ggcgaacaggtcatcaagctgcgcccaggcaaggtctacatgcagccgaatggctacaag
accgaaatgcagcggcacccggcggcacccagctggcgcattatcggcaccgacccggaa
ggcacgttctgccacaagccgtgcacggtgtccggcggcggcaagtcggaaatctccaag
tcactggacgacgcggtgatttatggcncggtgttcgtgcaggatttcgagacggacatg
gatcaggtggaagcgattttcaaccgggattacagcacgcggctgaagccagagtgtgcc
cacgaagaccgcgacccgcgccgccagcccttgagcaaggaacgcagcctcggctccttc
atcaagctgctgacgccttcgcccggcaatacggacgcctacaacgactggctggcaggc
atcccgccccgcatcctgtcgcaggcgttcatcatcaagcgcatgtacaagccggaatgg
nctgatggctggcgcagccatttttcggtggatgtgatcaacggcatgccaggccatgcg
ctgaaatgcgaaggccgggatttggtcgcctcctacctgcgggtggggctgggcaagtcg
ggcaactggcataccttcaaggtgcggcaagatttcatcgccaccgaaaaggtgcagatg
gaggatgacatcaccgcgtcggtggtggtcaatgcggcggtgctgcccaaccgctcgccc
aaatcttccaaccccagcgtcaaactggcgaaaaactgcgaataccgtttgttccagcgt
ccggacgaggccatccatcgcggtttcgacaagcagaccgaaagcgatatggcgcagccg
ggcaacttcatcgccaacttcgagccgctccacggcgatggcttggccacattggtggag
gatgtcgtcgagttccagctctacaccgcgccgatgcgcaacctgttgcaggcggcgtgc
gcatccggcgaatatgtggtgtcttccgccaacccgcgtctggtgggcggcaagccgagc
aagaacccgcgctatttgcaggtgcgcccggatttgcagcagccgatgcggacgtacatc
gcggaaatcggcgcgcgtttcaagcggcgcataccgttggggcagcctttgatcacggag
gtgaacggtgtcctgagcgggcggcgcaacaatccgccggagccgggcatccgtccgctg
gcggtgttcaacccgatccattaccaggaattgccggaactgttcatggacttcatttgc
agcgtcaccggcaagtcgccctccaccaccggcgcgggcagcgaaggcgcgctgaccaag
nggccgttcaacgccttgcgcgccacggctgacctgaacaatacgctggtgtcgttcctg
atcagcgggtatgcaggcttttccagcgcggcgggttatatcggtgccaaccaacgggtc
gaccatgacatcagcctgctgattccggaaatctgggcgcgcctgaatgaaagcgaacgt
gacccggactacttgatcgggcatggctacctggaaaagctggaagactttgactacgac
ggcaagcgggtgctggccagccgtctcggctaccgcatcaccgaccgttttgtcgccgcc
ttcatgggcaagattttcgacaatccggcggtggtgttcggcgaagacatcctcaagccg
gaaacgcagggtctggacgtgttcgcggatggcgtcaacaacattgtggaggcgcagcag
caagccgcccagcgctatctggacgacggcagcatcgacgacgcctgccctccgctcaag
gcgctgctttacatcatggcgaccggcagttttgagggcaaggacgtgcgccatcctgcc
atccgcgccctgttcacccgtgattacctgctggcgtcgcgctggtaccagcaacgcctg
gaaaccaagcagcagcgtgatgtggcgctgtgggaacggcattgccgctatttgcagcat
ttcctggagctggaaacgcaccgcgacgtggccgagcgcctggacatcgccgggaaactg
catcaggcgcaggcgaagctggcggccatccgcacaccggaatacctgcgcagcttgcgc
ggcaccatcggcgcggatctgttgggcgcgtactga

DBGET integrated database retrieval system