KEGG   Tarenaya hassleriana (spider flower): 104800577Help
Entry
104800577         CDS       T04125                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj03030  DNA replication
thj03410  Base excision repair
thj03420  Nucleotide excision repair
thj03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:thj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104800577
   03410 Base excision repair
    104800577
   03420 Nucleotide excision repair
    104800577
   03430 Mismatch repair
    104800577
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:thj03032]
    104800577
   03400 DNA repair and recombination proteins [BR:thj03400]
    104800577
Enzymes [BR:thj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104800577
    6.5.1.6  DNA ligase (ATP or NAD+)
     104800577
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     104800577
DNA replication proteins [BR:thj03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    104800577
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     104800577
DNA repair and recombination proteins [BR:thj03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     104800577
   NER (nucleotide excision repair)
    Other NER factors
     104800577
   MMR (mismatch excision repair)
    Other MMR factors
     104800577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 104800577
NCBI-ProteinID: XP_010521722
LinkDB All DBs
Position
Unknown
AA seq 795 aa AA seqDB search
MIAARSCIHFRCICPLPKTLPFPFSLISPSSRRHFLSLNLSSTRKTMSSSSRPSAFDALM
SNARAAAAKKKTTPQPSTSSRSPKKRKAENAQPTDPAKASVSESVVAKSENSRGPITDST
KLSSNSSPIADDSKNEGKKLKVLSQAEKITELKSKIGLLKKKTSDFDPKAVSCWEKGERV
PFLFLCLAFDMISHETGRIVITDILCNMLRTVIATTPEDLVATVSLSANEIAPAHEGLEL
GIGDASIKKALAEAFGRTEKQVDKEYKELGDLGLVAKASRSSQSMMRKPEPLTIVKVFDT
FRLIAKEAGKDSQEKKKNRMKALLVAATDCEPQYLTRLLQAKLRIGFSVQTLLAALGQAA
VYNEEHSKPPPNIQSPLEEAAKIVKQVYTVLPVYDKIVPALLSGGIWNLPKTCNFTLGVP
IGPMLAKPTKGVAEILNKFQDIVFTCEYKYDGERAQIHYMEDGSFEIYSRNAERNTGKFP
DVALALSRLKKPSLKSFVLDCELVAYDREKKKILPFQILSTRARKNVSVNDIKVDVCIFA
FDMLYLNGQQLLQENLSTRREKLYDSFEEEPGYFQFATALTSSDIEEIQKFLDAAVDSSC
EGLIIKTMDLDATYEPAKRSNNWLKLKKDYMDSIGDSVDLVPIGAFHGRGKRTGVYGAFL
LACYDTEKEEYQSICKIGTGFSEVVLEERSSSLRSKTIPAPKPYYRVGDTLNPDVWFEPT
EVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKQPEEATSSEQIADMYQA
QKHNHPNKKDDSEDE
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgatagctgctcgatcatgcattcactttcgctgcatatgtcctctccctaaaacccta
ccttttcccttctccctcatttcgccttcttctcgccgccactttctctccctgaacctt
agctcgactcgcaaaaccatgtcttcttcctcccgcccttccgcatttgacgcgctcatg
tccaatgcacgcgccgccgcggctaagaagaagacgacgcctcaaccctccacttcgtct
cgctcgccgaagaaacgcaaagctgagaatgcccaacccaccgatccggcgaaagccagt
gtttctgaatctgtagtcgccaagtcggagaattcgagagggcccataacggattccacg
aaactcagttcgaattcgtcgccgattgcggatgactcaaagaatgaggggaaaaagttg
aaggtgctgagccaagcggagaaaattactgaattgaagagtaaaattggattgttgaag
aagaagacaagtgatttcgatccgaaagcagtgtcttgttgggagaagggagagagagtc
ccgtttctttttctttgcctggcttttgatatgatatcacatgaaaccggtcggattgtg
atcactgatattctgtgtaacatgttgagaactgtaattgcgaccactccggaagatttg
gtggcaactgtttctctctcggccaatgagattgctcctgctcatgagggtttggagttg
ggaatcggggatgcttccattaagaaggcacttgccgaagcatttggcagaacagagaag
caggttgataaggagtataaggagctgggagatttggggctggtagcaaaagcaagccgg
tcgtctcaatctatgatgcggaagcctgaaccattgacgattgtcaaggtcttcgataca
tttcgactaattgcaaaggaagctggaaaagatagtcaggagaagaaaaagaaccgtatg
aaggcacttcttgtggctgcaacagactgtgaacctcaatatttaactcgtctacttcag
gcgaaactgcgtatagggttctcagttcagactctcttagctgccctgggacaagcagca
gtatacaatgaagagcattcaaagccgcccccgaatatccagtctcctttagaagaggct
gcgaagatagttaaacaagtatacaccgtgcttcctgtctatgacaagattgttcctgct
cttcttagtggtggtatatggaatcttccaaagacttgcaactttacattgggtgttcca
attggacccatgcttgcaaaaccaacgaaaggggttgcagagatactaaataaattccag
gacattgtttttacatgtgaatacaagtacgatggagaacgtgcccagatacattacatg
gaagatggttcttttgagatatatagtcgaaatgctgaaagaaatactggaaagtttccc
gatgttgctcttgcattgtcaagattaaagaagccctctttgaaatcatttgttttggat
tgtgagcttgttgcttacgatagagagaagaagaaaattcttcctttccagattctcagc
acccgagcccgtaaaaatgtgagtgtcaatgatatcaaggttgatgtctgcatctttgca
ttcgacatgttatatttaaatggccagcagctactacaggagaatctgagcactcgccga
gagaagctatacgattcatttgaggaagaacctggctattttcagtttgcaactgctcta
acatccagtgacattgaagaaatacagaaattccttgatgctgctgtcgattcgagctgt
gaaggtttaataattaaaacaatggacttggacgctacctatgagcctgcaaagcgatcg
aataattggctaaaactgaagaaagattatatggacagtattggtgactcagtggatctt
gtacccattggagctttccatggaagaggcaaacgcacaggtgtctatggtgcattttta
ttagcttgctatgatactgaaaaggaagaataccagagcatctgcaagattggtactgga
ttttctgaagtggtgcttgaagaacgatcctctagtcttcgttctaaaacaattcccgcc
ccaaagccgtactatcgagttggagataccctcaatccagatgtctggtttgagccaact
gaggtttgggaagtcaaagctgcagacttgacaataagccctgtgcaccgtgcagccatt
ggcattgtggatcctgataagggaatatctcttcgatttcctcgtcttgtgcgtgtacgt
gaagacaagcagccggaggaagcaacatcgtctgagcagatcgctgatatgtaccaagct
caaaagcacaatcatccaaacaaaaaagacgatagtgaagacgagtga

DBGET integrated database retrieval system