KEGG   Tarenaya hassleriana (spider flower): 104800726Help
Entry
104800726         CDS       T04125                                 

Definition
(RefSeq) anthranilate synthase alpha subunit 2, chloroplastic
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
thj01100  Metabolic pathways
thj01110  Biosynthesis of secondary metabolites
thj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    104800726
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    104800726
Enzymes [BR:thj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     104800726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 104800726
NCBI-ProteinID: XP_010521932
LinkDB All DBs
Position
Unknown
AA seq 613 aa AA seqDB search
MSSTSLFSVKSNFSAVEALALTPRPSPAASPPATSLHFNGGASISRSEVLRVCNASSRLH
PIRCSSSSAPSLDSSVDQLTKFKEAAGKGNLVPLYRCVFSDHLTPVLAYRCLVKEDERDA
PSFLFESVEPGLEASNIGRYSVVGAQPTIEIVAKGNVVTVMDHGAGHRTEEVVEDPMMVP
QKIMEAWNPQRTDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSNAPEDDRNLPDVHLGLY
DDVIVFDHVEKKAYVIHWVLIDKNRSIEENFTDGMSRLESLLSRIQDQKLPRMPSGLIKL
QTQLFGPKLKKSSMTNEAYKKAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALR
IVNPSPYMAYLQARGCILVASSPEILLRSKNRKITNRPLAGTVRRGKTPKEDVMLEKELL
SDEKQCAEHIMLVDLGRNDVGKVSKAGSVKVEKLMNIERYSHVMHISSTVTGELLDDLTS
WDALRAALPVGTVSGAPKVKAMELIDEVEVTRRGPYSGGFGGISFSGDMDIALALRTMVF
PTNSRFDIMYSYKHPQKRREWIAHIQAGAGVVADSDPDDEQRECENKAAGLARAIDLAES
SFLGTDTPQINNA
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccacttctctcttctctgtcaagtccaacttctccgccgtcgaagccctagcc
ctaacgccccgcccttcccctgccgcttctccgccggcaacttctcttcacttcaatggc
ggagcctcgatctcccgatccgaggtcctccgagtctgcaacgctagctcgcgtctccat
ccgatcagatgctcttcttcatctgctccatctttagattcttcagtagatcagttgaca
aagttcaaggaagcagcgggaaagggaaatttagttcctctgtacagatgcgtgttctcg
gatcatttgactcccgtacttgcttaccgatgtttggtgaaagaggacgagagagatgct
ccaagcttcttgttcgagtcggtggagcctggtttggaagcttccaatatcggaaggtat
agtgtagttggagctcagcctacaatagaaatcgtggcgaagggaaatgtcgttacggtt
atggatcacggagcagggcataggacggaggaggtggtagaagatccgatgatggttcct
caaaagataatggaggcttggaatccacagcgcactgatgagttgccggaagccttctgt
ggtggttgggttggatatttctcatatgataccgtgcgttacgttgagaagaagaagctg
cctttctcgaatgctccggaggatgataggaaccttcctgatgttcatttgggcctttat
gatgatgtgatcgtgtttgaccacgtcgagaagaaagcatatgtaatccattgggtgctg
atagataagaatcgttccattgaagagaacttcactgatggaatgagtcggttggaatcc
ctattgtctagaattcaagaccaaaagctcccaaggatgcctagtggtcttataaagcta
cagacccaactatttggtcctaaattgaagaaatcaagtatgacaaatgaggcatacaag
aaagcagtattagaagccaaagaacatatcctggctggagacattttccagatagttctt
agtcagcgatttgagaggcggacatttgcggacccatttgagatctacagagccttgagg
attgttaatccaagtccttatatggcttatttgcaagcgagaggatgcatattagtcgct
tcaagtccagaaatcttgttacgttcaaaaaataggaaaatcaccaatagacctcttgct
ggaactgtcagacgaggaaagacacccaaggaagatgtaatgctggagaaagagcttttg
agcgatgaaaaacagtgtgcagaacatattatgcttgttgacttgggtagaaatgatgtc
ggcaaggtatcgaaggccggctctgtgaaagttgagaagctcatgaacatagaacggtat
tcacatgtcatgcacataagctccacggtgacaggtgaactgcttgacgatctaacaagt
tgggacgctcttagagcagcacttcccgtcggaacagtcagcggagctcctaaggtgaaa
gccatggagctaatagacgaagtggaggtgacaaggcgtggaccatacagcggaggcttc
ggaggtatatccttcagcggagacatggacattgcccttgctttaaggactatggtcttc
cccaccaattctcgcttcgacatcatgtactcttacaagcatcctcagaaacggcgcgaa
tggatcgctcatattcaggccggggccggggtcgtggccgacagtgaccccgatgacgag
cagagggaatgcgagaacaaggccgcgggtctggcccgagccattgacctggccgagtct
tcctttcttggaaccgacactccccagataaataacgcgtga

DBGET integrated database retrieval system