KEGG   Tarenaya hassleriana (spider flower): 104804544Help
Entry
104804544         CDS       T04125                                 

Definition
(RefSeq) probable hexokinase-like 2 protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00010  Glycolysis / Gluconeogenesis
thj00051  Fructose and mannose metabolism
thj00052  Galactose metabolism
thj00500  Starch and sucrose metabolism
thj00520  Amino sugar and nucleotide sugar metabolism
thj01100  Metabolic pathways
thj01110  Biosynthesis of secondary metabolites
thj01200  Carbon metabolism
Module
thj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
thj_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104804544
   00051 Fructose and mannose metabolism
    104804544
   00052 Galactose metabolism
    104804544
   00500 Starch and sucrose metabolism
    104804544
   00520 Amino sugar and nucleotide sugar metabolism
    104804544
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104804544
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:thj04131]
    104804544
Enzymes [BR:thj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104804544
Membrane trafficking [BR:thj04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104804544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF1421
Motif
Other DBs
NCBI-GeneID: 104804544
NCBI-ProteinID: XP_010527158
LinkDB All DBs
Position
Unknown
AA seq 493 aa AA seqDB search
MNRNQAALFTVTAVAATVVAVRWWLRRKERRLKQSERILRKFARECATPAAKLWDVADAL
VADMNASLSGDKSPASSLDMIVSFAAPLPSGEEKGLYYGINLRGKDFMMLRARLRGKDEP
ISDVQKQEISIPDDVLHSSSSEELCDFISMELVKFVGMNPPDDDEDEDEEEKKLGFTLSH
SVEQEDSASCSVIQRKSLAFDQVEKEFVKEMNEALKKRGLKMQIHALADNVVGDLAGGRY
YSSDTVAAITLGMGTNAAYVQQAREITRWNCSVPESGEIVISTEWGDFSSTHLPLTEFDA
SLDAESLNPGRRRFEKMVSGGYLGEVVRRVLLRMAEESALFGELVPSKLRVPYVLRSPDM
AAMHQDTSEDRDTVNEKLKDVFGIDDSTREAREVVIEVCDVVAERAARLAGAGLVGIIKK
AGRLETMMSTVTVEGGLYGHYRVFRNYLHSGVWEMLGRELSDHVVVEHSHGGSGAGAIFF
AACGGGGGQDSES
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaaatcaggccgcattgttcaccgtgacggcggtggctgcgacggtggttgcg
gtgaggtggtggctgcggaggaaggagaggcggctgaagcagtcggagaggatccttcgg
aagtttgcgcgggaatgcgccacgccggcggcgaagctgtgggatgttgccgacgcattg
gtcgccgacatgaacgcatctctttccggcgacaaatcccctgccagttccctcgacatg
atcgtctccttcgccgctcccttgccctcaggggaggagaagggactgtactatggaatt
aatctacgaggcaaagatttcatgatgttacgcgcgaggttacgaggaaaggacgaaccc
atctccgatgtccagaaacaggagatctcgatcccagatgatgttttacacagttcatct
tccgaggagctctgcgacttcatttccatggagttagtgaaatttgtcgggatgaatccc
ccagacgatgatgaagatgaagacgaagaagaaaagaaactagggtttacgttatcgcat
tcagttgagcaagaggattcagcttcatgctcagtcatacagaggaagagcttagcgttt
gaccaggttgagaaggagttcgtgaaagaaatgaacgaagcgttgaagaaacgaggtcta
aaaatgcagatccacgcgttggcggataatgtggtcggagacttggccggaggaagatat
tacagcagtgacactgtcgccgccatcacattagggatgggaacaaatgccgcttatgtt
cagcaagctcgggagatcacgagatggaactgttcggtaccagagtctggcgagatcgtt
atcagtacagagtggggggatttcagttcaacccatcttcctcttaccgaattcgacgcc
tctctcgacgctgaaagcttgaatccgggacgcagaaggttcgagaagatggtgtccgga
ggatatttaggggaagtggtgagaagagtgcttctaagaatggctgaggaatctgctctt
ttcggagaattagtaccttctaaactcagagttccttacgttttaaggtcgcccgatatg
gccgccatgcatcaggatacatcagaggatcgagacaccgtgaacgaaaagctaaaggac
gttttcgggatcgatgattcaactcgtgaggcgagagaagtggtgatcgaagtgtgtgat
gtagtagccgaacgagcagcccgactggcaggagcaggactggtcgggataatcaagaag
gcgggaagactcgagacgatgatgagcacggtcaccgtggaaggaggattgtacggccat
tacagagtgttcaggaactaccttcacagcggcgtctgggaaatgctcggtcgagagttg
tcggatcacgtcgtggtcgagcattctcacggcggatccggagccggagctattttcttc
gccgcttgtggcggcggcggcggacaagattctgaatcttga

DBGET integrated database retrieval system