KEGG   Tarenaya hassleriana (spider flower): 104805354Help
Entry
104805354         CDS       T04125                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00020  Citrate cycle (TCA cycle)
thj00190  Oxidative phosphorylation
thj01100  Metabolic pathways
thj01110  Biosynthesis of secondary metabolites
thj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104805354
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104805354
Enzymes [BR:thj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104805354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 104805354
NCBI-ProteinID: XP_010528199
LinkDB All DBs
Position
Unknown
AA seq 282 aa AA seqDB search
MASGLIGRVVGAKPARLSVAARLIQSRWMASETEAQKVEPKASSGGGGSNVKTFQIYRWN
PDNPSKPQLQDYQIDLKECGPMVLDALIKIKNEIDPSITFRRSCREGICGSCAMNIDGCN
GLACLTKIQSGPSPTTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPEVPGKEI
LQSKKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTEER
LDAINDEFKLYRCHTILNCARACPKGLNPGKQIAHIKQLQLS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccggtttgatcggaagggtggttggggcaaagccggcgaggctatccgtggcg
gcgcgtctaattcagtcgcggtggatggcttcggagactgaggcgcaaaaggtcgaaccg
aaggcatccagcggcggcggagggtcgaacgtgaagactttccagatctatcggtggaat
ccggataatccttcgaagccccagcttcaggattaccagatcgatctgaaggagtgtggc
ccgatggttctcgatgctctgatcaagattaagaacgagattgatccgtcgatcactttc
cgtcgctcgtgccgggaagggatctgcggttcgtgcgcgatgaacatcgacggatgcaac
ggtctcgcgtgtctcacgaaaattcaatctgggccttcgccgacgaccatcaccccgttg
ccgcatatgttcgtgattaaggatctggttgtggatatgacgaacttttacaaccagtac
aagagtatcgagccatggttgaagaggaagaacccaccggaggttcctgggaaggagatt
ctgcagagcaagaaggatagggctaagctcgacgggatgtacgagtgtatcctgtgcgct
tgctgcagcacatcctgccccagctactggtggaacccggagtcctaccttggccctgca
gctttgctccacgccaataggtggataagcgacagccgtgatgagtacactgaggaaaga
cttgatgccatcaatgatgagttcaaactgtaccgttgccatacaatcttgaactgtgcc
cgagcttgtccgaagggattgaatccgggcaagcagatcgcacacatcaagcagcttcag
ctgtcttaa

DBGET integrated database retrieval system