KEGG   Tarenaya hassleriana (spider flower): 104805591Help
Entry
104805591         CDS       T04125                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj03030  DNA replication
thj03410  Base excision repair
thj03420  Nucleotide excision repair
thj03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:thj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104805591
   03410 Base excision repair
    104805591
   03420 Nucleotide excision repair
    104805591
   03430 Mismatch repair
    104805591
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:thj03032]
    104805591
   03400 DNA repair and recombination proteins [BR:thj03400]
    104805591
Enzymes [BR:thj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104805591
    6.5.1.6  DNA ligase (ATP or NAD+)
     104805591
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     104805591
DNA replication proteins [BR:thj03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    104805591
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     104805591
DNA repair and recombination proteins [BR:thj03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     104805591
   NER (nucleotide excision repair)
    Other NER factors
     104805591
   MMR (mismatch excision repair)
    Other MMR factors
     104805591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL Lactamase_B_2 UBA_4 SGT1
Motif
Other DBs
NCBI-GeneID: 104805591
NCBI-ProteinID: XP_010528511
LinkDB All DBs
Position
Unknown
AA seq 1441 aa AA seqDB search
MASESSTTIPFAGISGTPATSGESPSGENTVTLTLNSSELFLSAVSSVSPPIQTSKPRFP
SPLVPASKRIPKTTFVVDFFRFPPSSDSSTTAAFFLSHFHSDHYSGLSASWSQGIIFCSD
TTARLVRDVLQVPSQFVFALPLQQTVVIDGCDVILIDANHCPGAVQFLFKLKLENGGFER
YVHTGDFRFCESMKLDPFLCEFVGCDGIFLDTTYCNKKFVFPTQEESVDYVASVVDKIGG
EFVEGKKRVLFLVATYVVGKEKILVEIARRCKRKIFVDTRKMSILRVLGFGEIGIFTEDE
NESDVHVVGWSVLGETWPYFRPNFARMKEIMNEKGYDKVVGFVPTGWTYEVKRNKFAVRS
KDSMEIHLVPYSEHSNYEELREYVKFLKPKRVVPTVGIDIEKLDSKQVSKMQKHFSGLVD
EMANKKEFLMGFYRGSCQKNEKIEIDVGLSLNRKHGKDEKADIACENNVPCGISNALLSS
GEPLLQGSVTGIHSSDTEKLLIELRDCLPAWVSGEQMLDLISRSENNAVEIINSFYELET
ELYKQASLSASNSQGQAIVFDDSVPLSQKCYVDSTPPEVYTSQKGFEVPSNVVLMKSTIS
PGKRKKNIGSKLNKKAKKDPKLEPLGPRQSTITKFFNKVLDNGPDFVGQPSETEECTTVG
NKVLNDASRGYKETVDQFINIVNGSESLRDYAASIIEKAKGDINRALDIYYSNPKEILGD
VCRGGMSSNLIQFMHVPQDCPSHEDKKASEKPGQTIKLSEETSLEANTESDYVSLPPEKY
EPVEHACWRDGQPAPYIHLVRTFTLVEGERGKIKAMSMLCNMFRSLLALSPEDVLPAVYL
CTNKIAADHENIDLNIGGSLITSALEEACGTSRSTMREMYNSLGDLGDVAQLCRQTQKLL
IPPPPLLVRDVFSTLRKISAQTGTGSTRQKKNLIVKLMRSCREKEIKFLVRTLVRNLRIG
AMLRTVLPALAQAIIMNSFRVLHNGEISDNCFREKIEVLSGAVVEAYNILPSLDVVVPSL
MEKGIEFSSSTLSMLPGIPIKPMLAKISNGVQECVKLFQDKAFTCEYKYDGQRAQIHKLL
DGTVRIFSRNGDETTSRFPDLIDIIKQFSSPAAETFMLDAEVVATDRKNGNKLMSFQELS
TRERGGKDSLVTLDRIKVDICVFVFDIMFINGEQLLAIPLHERRERLKEVFPETRPGYLD
YAKEITVEAEVASLNNEDTLGRISAFLEESFQSSCEGIMVKSLHSDSGYFPSKRSDSWLK
VKRDYVEGLNDTLDLVPIGAWHGNGRKAGWYSPFLMACFDPETEEFQSVCRVMSGFSDAF
YIEDETKLSSESLFCFRKMKEFYSGDKILAKKPPYYRTAETPDMWFSPELVWEIRGADFT
VSPVHHAAIGIVHPSRGISIRFPRFIRKVTDRNPEECITSADIAEMFHSQTRKMNIAASH
H
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgagtcctccacaaccataccgttcgccggaatctccggaacccccgcaacc
tccggcgaaagcccaagcggcgagaacactgtaaccctaaccctaaactcgtcggagctc
ttcctctccgccgtctcatccgtttctccgccaattcagacatcgaaaccgcggttccct
tctcctttggtccctgcgtcgaagcggatacccaaaaccacctttgttgtcgatttcttc
cgcttcccaccatcctccgattcgtccaccaccgcagctttcttcctctcgcacttccac
tccgaccactactccggtctctctgcttcttggtctcaaggaattatattctgctccgac
acgacggctcggcttgtgagggatgtccttcaagttccctcacaatttgtcttcgctttg
cctttgcagcaaacagtagtgatcgatggatgcgatgtgatactgattgatgccaaccac
tgccccggtgccgtgcagtttttgttcaagctcaagctcgagaacggcggtttcgagagg
tacgttcatactggcgatttcagattctgtgaatcgatgaaattggaccctttcctttgt
gaatttgttggttgtgatgggattttcttggacacaacttattgcaacaaaaaattcgtt
tttccgactcaagaggagtctgtggattatgtggctagcgtggtagataagattggcggg
gagtttgtggaggggaagaaaagggttttgtttcttgttgccacttatgttgttgggaaa
gagaagattttggttgagattgcgaggagatgcaagaggaaaatcttcgtggacacgaga
aaaatgtcgattttgcgtgtcttgggatttggagagattgggatatttacagaggatgag
aatgagagcgatgttcatgttgtggggtggagtgtactgggtgagacgtggccatacttt
cgaccaaattttgcgaggatgaaagagatcatgaatgagaaagggtatgataaggtcgta
ggttttgtacctactgggtggacttatgaagtgaaacgcaataaatttgctgtaagatct
aaggattccatggagatacatcttgttccatatagtgaacactcaaactatgaagagctt
agggagtatgtaaagttcttgaagcctaaacgagttgttcctacggttggaattgatatt
gagaagctagacagcaagcaggttagtaaaatgcagaagcatttttctggactggttgat
gaaatggctaacaaaaaagagtttttaatgggtttctatcgcgggtcttgccagaagaat
gagaaaatagaaatagatgtcgggttaagcttgaacagaaagcatggaaaagatgagaag
gcagatatagcctgcgaaaataatgttccatgtgggatatcaaatgctttactttcatct
ggagagcctctattacagggttcagtgacaggaatccattcttcagacactgagaaattg
ttgatagaactgcgtgattgtttgcctgcatgggtctctggagaacagatgttggatctc
attagcaggtcagaaaacaatgctgtagaaataattaatagcttttatgaactggaaaca
gagctttataagcaagcctctctttctgcatctaattcgcaaggccaagccattgtgttt
gatgacagcgtacccctttcacagaaatgttatgttgacagcactccaccagaggtttac
acgagtcaaaaaggctttgaggtaccaagtaatgtggttttaatgaagagtaccatttct
cctgggaaaaggaagaaaaacataggcagcaaattaaacaaaaaggccaagaaagatcca
aaactggaaccattgggtccaaggcagtcaaccataactaagttcttcaataaggtcttg
gataatggacctgattttgttggtcagccttcagagactgaggaatgcacaacagttgga
aataaggtcctgaatgatgctagtagagggtacaaagaaacggtagatcagtttatcaat
atcgtaaatggttcagaatctttaagagattatgctgcatccattattgagaaggctaag
ggagatataaatagggcattggatatctattatagcaatcccaaggaaatacttggtgat
gtatgtcggggaggaatgtctagtaatttaattcagtttatgcatgttccacaagattgt
ccctctcacgaggacaaaaaggcttcagagaaaccaggacagacaattaagttatctgag
gagacatcactagaagcaaacacggaatcagactatgtatcattgcctccagaaaaatac
gaacccgtagagcatgcatgctggagggatggacagcctgctccatatatccaccttgtc
cgaacctttacattagtggaaggtgaaaggggcaagatcaaagctatgtctatgctgtgc
aacatgtttagaagcttgttggccctgtcgcctgaagatgtgctgcctgctgtttatctg
tgcacgaataagattgctgcagatcatgaaaacattgatctcaatattggtggaagtttg
atcacatctgccttggaagaggcatgtggaacaagtcggtctaccatgagggagatgtat
aatagcctgggtgatcttggggatgtcgctcagctatgtcgtcagacacaaaagctactt
attcctcctcctccacttctagtgagagatgttttttcaactctgcgaaagataagtgcg
caaacaggtactggaagtactaggcagaagaaaaacctcattgtgaagctaatgcgctct
tgtagagagaaagagattaagtttcttgttagaacattggtccgtaatctgagaattggt
gccatgttgagaactgttctgcctgcactggcccaagctataataatgaattctttccga
gttttacataatggagaaatatcagacaattgtttcagagagaaaattgaggttctttct
ggtgcagtggttgaggcatacaacatacttccttctttggatgttgttgttccttctctc
atggaaaaaggcattgagttttcatcatcaactctttcaatgctcccagggatacctatt
aaaccgatgcttgcaaaaatttctaacggggttcaagaatgtgtaaagcttttccaagac
aaggcgtttacatgtgaatacaaatatgatggtcagcgtgcccagatccataagcttctt
gatggtactgtgcgtatcttctctcgaaatggggatgaaacgacctcgaggtttcctgat
ttaatcgatataattaaacaattttcaagccctgctgctgagacattcatgttggatgct
gaggtggtagcaactgacaggaagaatgggaataagctcatgtcattccaagaactatcc
accagagagagagggggcaaagattctttagtaactcttgaccgtatcaaggttgatatc
tgcgtttttgtgtttgatatcatgttcatcaatggagaacagcttttggctattccactc
catgaaagacgagaacgtctgaaagaggtcttccctgagacccgtccgggctatttagac
tatgccaaggaaatcactgtggaagcagaagtcgcctcgctgaacaatgaagacactttg
ggcagaataagtgcttttctagaagaatcatttcagtcgtcatgtgaagggatcatggtt
aaatctctacattctgattccggatactttccctcaaagcgctctgattcatggctcaag
gtcaagcgagattatgtcgaaggattgaacgacacactggatttagttcctatcggtgct
tggcatggaaatgggagaaaagcaggatggtatagtccattcctcatggcgtgcttcgac
cccgaaacagaggagttccagagtgtctgccgtgtcatgtctgggttctccgacgctttt
tacatcgaggatgaaacaaaattatcatcggaatctcttttctgttttcggaagatgaaa
gaattctactctggggataagatccttgccaaaaagccaccttactacagaactgcagag
acgcccgacatgtggttctcaccagagctcgtgtgggaaatcagaggtgcggatttcaca
gtctcacccgttcatcacgcggctataggcatcgtccatccatcccgaggcatctccatc
aggttcccgagattcatccgcaaagttacggatcgaaacccagaggaatgcatcacatct
gcagatattgcagagatgttccattctcagacccggaaaatgaacatcgctgcttctcat
cactaa

DBGET integrated database retrieval system