KEGG   Tarenaya hassleriana (spider flower): 104806748Help
Entry
104806748         CDS       T04125                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00010  Glycolysis / Gluconeogenesis
thj00030  Pentose phosphate pathway
thj00051  Fructose and mannose metabolism
thj00052  Galactose metabolism
thj01100  Metabolic pathways
thj01110  Biosynthesis of secondary metabolites
thj01200  Carbon metabolism
thj01230  Biosynthesis of amino acids
thj03018  RNA degradation
Module
thj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104806748
   00030 Pentose phosphate pathway
    104806748
   00051 Fructose and mannose metabolism
    104806748
   00052 Galactose metabolism
    104806748
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    104806748
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:thj01009]
    104806748
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:thj03019]
    104806748
Enzymes [BR:thj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     104806748
Protein phosphatases and associated proteins [BR:thj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104806748
Messenger RNA biogenesis [BR:thj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     104806748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 104806748
NCBI-ProteinID: XP_010530089
LinkDB All DBs
Position
Unknown
AA seq 459 aa AA seqDB search
METNASISPAWEETLSLASVTIKSLPHLPDLQTRRRCNPLDLNPFFRPSDGFYITPSDVI
LRQILSDDFSTPRVAYHRAGPRREIMFEPSHVKAAIVTCGGLCPGMNTVIREVVVGLWEL
YGVRDIYGIRAGYRGFYSMEPMKLNPKMVDDWHKRGGTVLETSRGGFDLLKIVDSIQTHG
FNQVYIIGGDGTMRGAVEIFNEICRRKLDICITGIPKTVDNDIGIIDRSFGFQTAVEMAQ
EAISAAHVEAESAVNGIGLVKLMGRSTGHIALYATLSSRDVDCCLIPEMKFYLEGKGGLF
EFLEQRLKENGHAVVVVAEGAGQDMIPRSETQKQERDESGNMVFLDVGIWLKSELKEWWA
KAHPGELFTVKYIDPMYMIRAVPANATDNLYCTLLAHSAIHGVMTGYTGFVSGPINGNYA
YIPLEEVAQSKNEVDTNDHKWAWVRSVTNQPDFQHNPGG
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggagaccaacgccagcatctctccggcgtgggaggagactctgtccttagcctccgtc
accatcaagagtcttccccatctccctgacctccagacgcgtcgccgctgcaacccactc
gaccttaatcccttcttcagaccctccgatggcttctacataaccccctctgacgtcatc
ctccgacagatcctctccgatgacttctccaccccacgagttgcgtaccacagagctggt
ccccgccgtgagatcatgttcgagccctctcatgtgaaggcggcgattgttacgtgtgga
gggttgtgtccaggcatgaacactgtcattagggaagtggtggttggtctttgggagctt
tacggtgtgagggacatctacggaatcagagctggttacagagggttttactccatggag
cccatgaagctcaatcccaagatggtcgacgactggcacaagaggggcggcactgtcctc
gagacctcccgcggtggcttcgatttactcaaaatcgtcgattccatccaaacccacgga
ttcaaccaggtctacattattggtggggatgggacaatgcggggggctgttgagattttc
aacgagatctgtcgccggaaactggatatctgcattacaggcatcccgaaaaccgtggac
aatgacattggcatcatcgaccgatctttcggttttcaaaccgcagtggagatggctcag
gaagctatatcggctgctcatgtggaggccgagagcgcagttaatggcatcggcctggta
aagttgatgggcaggagcactggccatattgcgctgtatgcaacgcttagcagccgcgat
gtagattgttgtctgatcccagagatgaaattttaccttgaaggcaaaggagggctattc
gagtttctggagcagagactgaaggaaaatgggcatgctgtggtcgttgtggctgaaggg
gcggggcaagacatgatccccaggagcgaaacacagaaacaagagagagatgagtctggt
aacatggttttcttggacgtgggcatatggttgaagtcagagctaaaggaatggtgggcg
aaagctcacccaggcgagttgttcacggtgaaatacatagatccgatgtacatgataaga
gctgtgccggcgaatgccacagataacttgtactgtacgctgttggcacactcagcaatc
catggagtgatgacggggtacactggtttcgtttctggccctatcaacgggaactatgct
tatatcccgttagaggaagtggcccagtctaagaatgaagtggacacgaacgaccacaaa
tgggcctgggtgaggtctgtcacaaaccagcctgattttcaacacaatccaggagggtag

DBGET integrated database retrieval system