KEGG   Tarenaya hassleriana (spider flower): 104810407Help
Entry
104810407         CDS       T04125                                 

Definition
(RefSeq) glutathione S-transferase U28
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:thj00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    104810407
Enzymes [BR:thj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     104810407
Transporters [BR:thj02000]
 Other Transporters
  Pores ion channels [TC:1]
   104810407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_C GST_N_2 GST_C_3 GST_C_6
Motif
Other DBs
NCBI-GeneID: 104810407
NCBI-ProteinID: XP_010534998
LinkDB All DBs
Position
Unknown
AA seq 222 aa AA seqDB search
MGKDNVVVLDFWASPYGMRTKIALAEKGVEFETRQEDLWNKSELLLKSNPVHKKVPVLIH
DDKPICESLVQVQYIDETWSKTGSFFPSDPYQRSQARFWADYADKKVSFEAGRKIWGTKG
EEQEQGKKELLESLKVLETELGDKAYFGGDSFGYVDITLVPFYSWFYALEKVGNFSVESE
CPKLFAWGKRCLLERESVSKSLPEPEKVYRQVLKLRKLFGIE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagacaatgtggtggttttggacttctgggcgagtccgtacgggatgaggacg
aagattgcgttggcggagaagggagttgagttcgagacacgacaggaagatctgtggaac
aagagtgaactgctcttgaagtcgaaccctgtccacaagaaagtgcctgtccttatccat
gacgataaacccatctgcgaatcactcgttcaggttcagtacatcgacgagacttggtca
aagaccggttctttctttccatctgatccttaccagagatctcaagcaaggttctgggca
gattatgcggacaaaaaggtatcattcgaagcgggaaggaagatatggggaacgaaaggg
gaagagcaggaacaaggcaagaaagaacttctcgagagcttgaaggttctagaaaccgag
ctaggcgataaagcctatttcggaggagattcattcgggtatgtagacataaccctcgtc
ccattctacagctggttctatgccctcgagaaggtcggtaacttctctgttgaatctgag
tgtccgaagctatttgcttggggcaaaagatgtcttcttgaacgtgaaagtgtctccaaa
tcactgcctgaaccagagaaagtgtaccgacaagtcctcaaactcaggaagttgttcggg
attgagtga

DBGET integrated database retrieval system