KEGG   Tarenaya hassleriana (spider flower): 104811484Help
Entry
104811484         CDS       T04125                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00040  Pentose and glucuronate interconversions
thj00051  Fructose and mannose metabolism
thj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    104811484
   00051 Fructose and mannose metabolism
    104811484
Enzymes [BR:thj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     104811484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 PALP Pyr_redox_2 UDPG_MGDP_dh_N Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 104811484
NCBI-ProteinID: XP_010536493
LinkDB All DBs
Position
Unknown
AA seq 364 aa AA seqDB search
MGKGGMSHEEAPKGLEENMAAWLVGLNTLKIQPFKIPSLGPHDVRVRMKAVGICGSDVHY
LKTLKCAHFEVKEPMVIGHECAGVIEEVGSEVKHLVPGDRVALEPGISCWRCNLCKDGRY
NLCPDMKFFATPPVHGSLAHQVVHPADLCFKLPENVSLEEGAMCEPLSVGVHACRRAEIG
PETTALVMGAGPIGLVTMLAARAFGVPRIVIVDVDDHRLCVAKQLGADDIVKVTTDMKDV
DAEVEEIRKAMGADIDVTFDCAGFNKTMSTALAATRCGGKVCLVGMGHGEMTVPLTPAAA
REVDVIGVFRYKNTWPLCLEFLKSGKIDVKPLITHRFGFSQKEVEDAFETSARGGNAIKV
MFNL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaggagggatgtctcacgaggaagctccgaaggggttggaagaaaacatggct
gcttggttggttggtctcaacacgctaaagatccaaccttttaagatcccttcgcttggt
cctcatgatgtcagagtcaggatgaaagctgtgggtatctgtggaagcgatgttcactac
ctcaagaccttgaaatgcgcgcatttcgaggtgaaagaaccgatggtgatcgggcatgaa
tgtgctggagtcattgaggaggtcgggagtgaggttaaacatctcgtcccgggtgatcga
gtggctctagagcccggaattagttgctggagatgcaacctgtgcaaggatggtcgatac
aatctctgcccggatatgaagttcttcgccaccccacctgttcatggctctcttgcccac
caggtggttcatcctgctgacctgtgctttaaattgcccgagaatgtgagtttagaggaa
ggagcaatgtgtgaacctctaagtgtcggtgttcatgcctgccgccgtgctgagatcggt
cctgaaactactgctttggtaatgggagccggccctatcggccttgtcaccatgctcgct
gctcgtgcctttggagttcccagaattgttattgtcgatgtcgatgatcaccgcttgtgt
gtagccaaacaactcggggcagatgacattgtcaaagtcacaaccgacatgaaggacgtt
gatgcggaagtggaagagatacgtaaggctatgggggcggacattgacgtgacctttgac
tgtgcgggtttcaacaaaacaatgtcgacagcacttgctgccacccgctgtggcggtaaa
gtctgtcttgtcggaatgggacacggcgaaatgacagtcccccttactcctgctgctgct
agggaggtggatgtgatcggagtgttcaggtacaagaacacgtggccactgtgtcttgag
ttcctcaagagtgggaagattgatgtgaagccgctcataactcacaggtttggtttctca
cagaaggaagtggaagatgcctttgagaccagtgctcgtggtggtaatgccattaaggtt
atgttcaatctttga

DBGET integrated database retrieval system